Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate SMc01635 SMc01635 oxidoreductase
Query= SwissProt::Q8P3K4 (300 letters) >FitnessBrowser__Smeli:SMc01635 Length = 253 Score = 152 bits (384), Expect = 8e-42 Identities = 92/249 (36%), Positives = 138/249 (55%), Gaps = 10/249 (4%) Query: 57 LQGKRCLITAAGAGIGRESALACARAGAHVIATD--IDAAA--LQALAAESDAITTQLLD 112 L + ++T AG+GIGR A AR GAHV+ D ++AA + A+AA + +D Sbjct: 3 LNNRIAIVTGAGSGIGRAGAAIMAREGAHVVVVDRSVEAAGDTVAAIAAGGGSAEALAVD 62 Query: 113 VTD----AAAITALVAAHGPFDVLFNCAGYVHQGSILDCDEPAWRRSFSINVDAMYYTCK 168 VTD A I ++ HG D+L N AG G + + + + RS+++NV A + + Sbjct: 63 VTDDDALADGIADILYRHGRIDILHNHAGAQVAGDLEEVEVAGFDRSWNLNVRAHFMAAR 122 Query: 169 AVLPGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNA 228 V+P M + GRG I+N SS +S + Y TK AVI +++ +A DY GVR NA Sbjct: 123 LVMPSMKKAGRGVIVNTSS-SSGVLYDREMIAYTTTKHAVIAMTRQMAGDYAKYGVRVNA 181 Query: 229 ICPGTIKTPSLGQRVQALGGDEQAVWKSFTDRQPMGRLGDPREIAQLVVYLASDESSFTT 288 +CPG + TP + +GG E A+ +R P+GR EIA+ +++L SD SS+ T Sbjct: 182 LCPGWVDTPFNEPFIDQMGGRE-AIEAYIRERVPLGRWASVDEIAESILFLVSDRSSYMT 240 Query: 289 GQTHIIDGG 297 GQ ++DGG Sbjct: 241 GQILVVDGG 249 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 253 Length adjustment: 25 Effective length of query: 275 Effective length of database: 228 Effective search space: 62700 Effective search space used: 62700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory