Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate SMc01582 SMc01582 alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >FitnessBrowser__Smeli:SMc01582 Length = 381 Score = 205 bits (521), Expect = 2e-57 Identities = 121/374 (32%), Positives = 192/374 (51%), Gaps = 13/374 (3%) Query: 14 GAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFDEVFPNPTE 73 GAG I ++ + K L+VTD L + + L+ + +F +V PNP + Sbjct: 16 GAGRIKELADHCKALGIKKPLLVTDRGLAPMAITQQALDILEAGGLGRAIFADVDPNPND 75 Query: 74 ELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGVG----KVKNAG 129 ++ G A++ D ++AFGGGS +D K V + P + +G + G Sbjct: 76 RNLEAGVKAFRDGGHDGVVAFGGGSGLDLGKCVAFMAGQTRPVWDFEDIGDWWTRASVEG 135 Query: 130 V-PLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPASVTA 188 + P+VA+ TTAGT +E+ +VI +SA VK+VI P +P + + D + + +P +TA Sbjct: 136 IAPIVAVPTTAGTGSEVGRASVITNSASHVKKVIFHPKFLPGVTICDPELTVGMPKVITA 195 Query: 189 ATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEAREQMAFGQYL 248 TGMDA H +EAY S HP++ ALE +RL+ +LP+A DG +LEAR M + Sbjct: 196 GTGMDAFAHCLEAYSSPFYHPMSAGIALEGMRLVKEYLPRAYKDGADLEARANMMSAAAM 255 Query: 249 AGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQAMGV 308 +AF GLG +H+L+H GA +N HG+ NA+++P V FNR + R A +G+ Sbjct: 256 GAVAFQK-GLGAIHSLSHPVGAIYNTHHGMTNAVVMPPVLRFNRSAIEEKIGRAAAYLGI 314 Query: 309 ETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADPCAPCNPRT 368 + + L + +G+P+ S LGV + I+ + A+ DP A NP Sbjct: 315 -------AGGFDGFYDYVLRLREELGVPDKLSALGVGTDRIDEMAEMAIVDPTAGGNPVE 367 Query: 369 ASRDEVRGLYLEAL 382 + D L+ E + Sbjct: 368 LTLDAAEKLFAECI 381 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 381 Length adjustment: 30 Effective length of query: 352 Effective length of database: 351 Effective search space: 123552 Effective search space used: 123552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory