Align Monosaccharide-transporting ATPase; EC 3.6.3.17 (characterized, see rationale)
to candidate SM_b21375 SM_b21375 sugar uptake ABC transporter permease
Query= uniprot:B2SYR4 (338 letters) >FitnessBrowser__Smeli:SM_b21375 Length = 320 Score = 203 bits (516), Expect = 5e-57 Identities = 112/314 (35%), Positives = 188/314 (59%), Gaps = 3/314 (0%) Query: 26 KAKWWQQITEYSLIVIFVVMFATM-SLTVDHFFSIENMLGLALSISQIGMVSCTMMFCLA 84 KA + + +Y I + +VM + S F ++ N + + ++ + + + M + + Sbjct: 8 KAALVRALKQYGGIFLSLVMLCIVFSFFNPRFMTVVNFMNILQQVAVVAIAAFGMTWVIL 67 Query: 85 SRDFDLSVGSTVAFAGVLCAMVLNATGNTFI-AIVAAVAAGGVIGFVNGAVIAYLRINAL 143 + DLSVGS +A AG++ A A G F AI +AAG ++G +NG + A L + + Sbjct: 68 LGEIDLSVGSIIAVAGMVGAQCF-AFGMGFAPAIALTLAAGALMGMLNGVLTAKLLLPSF 126 Query: 144 ITTLATMEIVRGLGFIVSHGQAVGVSSDTFIALGGLSFFGVSLPIWVTLLCFIVFGVMLN 203 I T+ATM I RG+ + ++G + ++T+ A+G SF G+ + IWV + F++ ++L+ Sbjct: 127 IVTVATMGIYRGMVSLPTNGAPAMIENETWTAIGTESFLGLPIIIWVVAVLFVINQIVLS 186 Query: 204 QTVYGRNTLAIGGNPEASRLAGINVERTRVYIFLIQGAVTALAGVILASRITSGQPNAAQ 263 +T +GR GGN EA+ +GI V+R ++ IF+I G + A++GV+L+SR+ S Q NA Sbjct: 187 KTSFGRRAYLTGGNREAAVYSGIKVDRLKILIFMISGVMAAISGVLLSSRLFSAQTNAGM 246 Query: 264 GFELNVISACVLGGVSLLGGRATISGVVIGVLIMGTVENVMNLMNIDAFYQYLVRGAILL 323 +EL+ I+A VLGG SL GG T+ G +IG LI+G + N MN++++ FYQ +V+G ++L Sbjct: 247 SYELDAIAAAVLGGTSLAGGVGTMVGTLIGALIIGVMNNGMNMLSVPYFYQLIVKGLVIL 306 Query: 324 AAVLLDQLKNRGSR 337 AV LD + R Sbjct: 307 VAVWLDVRAKQAKR 320 Lambda K H 0.326 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 320 Length adjustment: 28 Effective length of query: 310 Effective length of database: 292 Effective search space: 90520 Effective search space used: 90520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory