Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate SMa2309 SMa2309 ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >FitnessBrowser__Smeli:SMa2309 Length = 273 Score = 176 bits (446), Expect = 5e-49 Identities = 96/270 (35%), Positives = 156/270 (57%), Gaps = 7/270 (2%) Query: 17 IYATLLLAAAV-YLIPLVVMLLTSFKSPEDIRTGNLLSWPT---VIDGIGWIKAWDVVGG 72 +Y T++ A + +L PL ++LTSF+S D+ +GNL WPT V++ + + G Sbjct: 6 LYMTVVGAILIIWLAPLFAVILTSFRSMADVMSGNLWGWPTEIAVVENYTAVFTQTPMAG 65 Query: 73 YFWNSVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCFLPFQTVLLPASFT 132 YF NS+ IT+P+V+ + + G+VL+ +RF G+ + F L + G FLP Q +++P Sbjct: 66 YFLNSLVITIPSVIGVLSLSTLAGFVLARYRFPGNMVIFALFVGGNFLPHQIMMIPVRDL 125 Query: 133 LGKFGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTIFLKILL 192 + + L +TTT L++ HV + F TLF RN+ ++PD L +AAR +GA F + +++ Sbjct: 126 MVRLNLYDTTTALIIFHVAFQTGFATLFMRNFIAALPDELFQAARAEGATPFQTLIHVVV 185 Query: 193 PMSIPIVMVCLIWQFTQIWNDFLFGVVF-ASGDAQPITVALNNLVNTSTGAKEYNVDMAA 251 P+ P I FT IWND+ + VV S + +P+T L NL A +N+ A Sbjct: 186 PLVRPAWAALAILLFTFIWNDYFWAVVLTVSDNVKPVTAGLANLRGEWVSA--WNLISAG 243 Query: 252 AMIAGLPTLLVYIFAGKYFLRGLTSGAVKG 281 +I +P ++++ K+F+ GLT GAVKG Sbjct: 244 TIIVAVPPVVMFFLMQKHFIAGLTMGAVKG 273 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 273 Length adjustment: 25 Effective length of query: 256 Effective length of database: 248 Effective search space: 63488 Effective search space used: 63488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory