Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate SMc04257 SMc04257 ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >FitnessBrowser__Smeli:SMc04257 Length = 305 Score = 288 bits (738), Expect = 8e-83 Identities = 138/281 (49%), Positives = 193/281 (68%), Gaps = 9/281 (3%) Query: 10 ISFSRIAIYATLLLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWPTVIDGIGWIKAW-- 67 +S I +Y TL++ A YL+PL VM++TS K +IR GN+ + P I W+KAW Sbjct: 25 LSRRNIIVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAE 84 Query: 68 -------DVVGGYFWNSVKITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLFGCFL 120 D + FWNSV+ITVP+V+IS I ++NGY L+ WRF+G+ LFF +L+ G F+ Sbjct: 85 ACTGLNCDGLSRGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFI 144 Query: 121 PFQTVLLPASFTLGKFGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDG 180 P+Q ++ P L + G+ T TGL++VH ++G+ TL FRNY+ +P+ L KAAR+DG Sbjct: 145 PYQVMIYPIVIVLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDG 204 Query: 181 AGFFTIFLKILLPMSIPIVMVCLIWQFTQIWNDFLFGVVFASGDAQPITVALNNLVNTST 240 AGF+TI+ KI+LPMS+PI +V +I Q T IWNDFLFGVVF + P+TV LNN+VN+ Sbjct: 205 AGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFGVVFTRPEYYPMTVQLNNIVNSVQ 264 Query: 241 GAKEYNVDMAAAMIAGLPTLLVYIFAGKYFLRGLTSGAVKG 281 G KEYNV+MAA ++ GL L VY +G+ F+RG+ +GAVKG Sbjct: 265 GVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 305 Length adjustment: 26 Effective length of query: 255 Effective length of database: 279 Effective search space: 71145 Effective search space used: 71145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory