Align ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized)
to candidate SM_b20661 SM_b20661 sugar uptake ABC transporter ATP-binding protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1897 (386 letters) >FitnessBrowser__Smeli:SM_b20661 Length = 355 Score = 353 bits (907), Expect = e-102 Identities = 190/365 (52%), Positives = 247/365 (67%), Gaps = 12/365 (3%) Query: 1 MATLELRNVNKTYGPGLPDTLKNIELKIDDGEFLILVGPSGCGKSTLMNCIAGLETISGG 60 MA ++ +V K++G P +K + ++I+DGEF+ILVGPSGCGKSTL+ +AGLE I+ G Sbjct: 1 MAGVDFVDVRKSFG-AFP-VIKGVNIEIEDGEFVILVGPSGCGKSTLLRMLAGLENITAG 58 Query: 61 AILVDDADISGMSPKDRDIAMVFQSYALYPTMSVRDNIAFGLKIRKMPTAEIDEEVARVS 120 I + + ++ + PKDRDIAMVFQ+YALYP M+V DN+AF L + P +EID+ V + Sbjct: 59 EIRIGNQVVNRLPPKDRDIAMVFQNYALYPHMTVADNMAFSLMLAARPKSEIDKRVGVAA 118 Query: 121 KLLQIEHLLSRKPGQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKL 180 ++L + LL R P QLSGGQ+QRVAMGRA+ R P+++LFDEPLSNLDAKLRV MR E+K Sbjct: 119 EILGLSKLLDRYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVAMRAEIKE 178 Query: 181 MHQRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPKDIYNNPANLFVASFIGSPP 240 +HQRLKTTTVYVTHDQIEAMT+ DK+ VM DGI++Q G P ++Y+NPANLFVA FIGSP Sbjct: 179 LHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGAPLELYDNPANLFVAGFIGSPA 238 Query: 241 MNFIPLRLQRKDGRLLALLDSGQARCELPLGMQDAGLEDREVILGIRPEQIILANGEANG 300 MN + RL D + D LP+ A + R+++ G+RPE + L + NG Sbjct: 239 MNMLKGRLDPADPSVFLTADG----TALPVARPAAAAQGRDLVYGLRPEYMAL---DPNG 291 Query: 301 LPTIRAEVQVTEPTGPDTLVFVNLNDTKVCCRLAPDVAPAVGETLTLQFDPAKVLLFDAK 360 LP AE+ V EPTG +T + L V C V GET+ L D A V LFDA Sbjct: 292 LP---AEIAVIEPTGYETQLIARLGGHDVTCVFRERVNAKPGETIHLAIDAAHVHLFDAG 348 Query: 361 TGERL 365 TG RL Sbjct: 349 TGRRL 353 Lambda K H 0.319 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 355 Length adjustment: 30 Effective length of query: 356 Effective length of database: 325 Effective search space: 115700 Effective search space used: 115700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory