Align Gluconolactonase (characterized, see rationale)
to candidate SMa0060 SMa0060 gluconolactonase
Query= uniprot:A0A165IRV8 (316 letters) >FitnessBrowser__Smeli:SMa0060 Length = 311 Score = 155 bits (392), Expect = 1e-42 Identities = 98/305 (32%), Positives = 143/305 (46%), Gaps = 17/305 (5%) Query: 21 VTGAVRCVIALGNALGEGVLWSVREQAVYWVDILGRELHRWDPATGAHQRWTFDEEISAI 80 ++ V ++ + +GE +LW E+A+YWVDI+G+ +HR +P G H W + +++I Sbjct: 1 MSATVSLLLDAKDIVGESILWCGDEKALYWVDIVGKRIHRLEPENGRHDTWPTPDFVTSI 60 Query: 81 AERAHAPGFIVTLRRGFALFDPATDMAPRYLHQPEPDRAGNRFNDGKCDAQGRFWAGSMD 140 R GFIV L R L+ P D PEPD NR N+G+ G FW +M Sbjct: 61 GMRKDG-GFIVGLSRNVCLWTP--DGPFEEFAMPEPDLPENRLNEGRVAPDGSFWVATMQ 117 Query: 141 FACEA---------PTGALYRYDSDGSCTR-HDDGFAVTNGPTWSGTGQGAAMFFNATIE 190 +A +GA+YR D G ++ + + +TN W+ + FF T+ Sbjct: 118 SNLDAGGSPKDMDRQSGAVYRIDPTGHVSQLTPNEYGITNTMGWTRDNR---FFFADTLA 174 Query: 191 GNTYRYDSDLATGTVSNKTLWKHWLPEDGLPDGMTTDAQGRLWIAHWGGWCVTCHDPVTA 250 Y +D DLA + N+ GLPDG DA RLW G Sbjct: 175 NEIYMFDCDLAARRIDNRRTIVAGFAR-GLPDGSCLDADDRLWNCRVAGGAAVAGFDGAG 233 Query: 251 AELGRVRLPVSQVTTCAFGGADLRTLFISSARVGLTPEQLAAEPLAGALFAVDTDSLGLP 310 + + LP S T+C FGG L TL+++SAR +T + L PL G LFAV+ G+ Sbjct: 234 RLMHLIELPASWPTSCTFGGPVLSTLYVTSARFTMTGDHLDMHPLEGGLFAVEGVGHGVE 293 Query: 311 AHPFG 315 FG Sbjct: 294 EPKFG 298 Lambda K H 0.321 0.137 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 311 Length adjustment: 27 Effective length of query: 289 Effective length of database: 284 Effective search space: 82076 Effective search space used: 82076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory