Align MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate SMc03000 SMc03000 ABC transporter permease
Query= TCDB::P23200 (336 letters) >FitnessBrowser__Smeli:SMc03000 Length = 326 Score = 183 bits (464), Expect = 6e-51 Identities = 108/318 (33%), Positives = 173/318 (54%), Gaps = 15/318 (4%) Query: 18 IYVVLLVLLAIIIFQDPTFLSLLNLSNILTQSSVRIIIALGVAGLIVTQGTDLSAGRQVG 77 + V + VLLA+I + P F++ NL+ + + +S+ +I+ALG +I+T+ DLS + Sbjct: 13 LVVAIAVLLALIALRFPAFVAPSNLARVYSDTSILVILALGQMAVILTRCIDLSMAANLA 72 Query: 78 LAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIGLINGLIIAYLNVTPFIT 137 L +VAA L N FP + PI L+I+ V A+G +G ING ++ LN+ P + Sbjct: 73 LCGMVAAML-------NNAFPGL---PIPLIIVAVMALGGFLGSINGTLVWKLNIPPIVV 122 Query: 138 TLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGSFRLSYITFYALIAVAFV 197 TLGT+ I G L + I+ + S + L + +++ +L+ VA + Sbjct: 123 TLGTLTIYRG---LIFVLTNGKWINAHE--MSDAFKALPRLDVAGMPVLSWLSLVIVALM 177 Query: 198 WVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGVFYAFGGMLEAGRIGSAT 257 +++ +T G+ +A+GGNP AA +G++VG Y LSG G L R A Sbjct: 178 FLVMGRTPLGRAFYAVGGNPHAAVYTGIDVGRTRFFAYCLSGALAGLSGYLWVSRYAVAY 237 Query: 258 NNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVINYGLTYIGVNPYWQYIIK 317 ++ +ELD IAACV+GG+S +GG+G+V G V G + VI L I ++P+ Q I Sbjct: 238 VDIAAGFELDIIAACVIGGISIAGGIGSVAGAVLGALFLGVIKNALPVINISPFAQLAIS 297 Query: 318 GAIIIFAVALDSLKYARK 335 G +II AVA+++ RK Sbjct: 298 GTVIIIAVAVNARAERRK 315 Lambda K H 0.327 0.143 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 326 Length adjustment: 28 Effective length of query: 308 Effective length of database: 298 Effective search space: 91784 Effective search space used: 91784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory