Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate SM_b21343 SM_b21343 sugar uptake ABC transporter permease
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Smeli:SM_b21343 Length = 334 Score = 199 bits (507), Expect = 6e-56 Identities = 124/334 (37%), Positives = 187/334 (55%), Gaps = 21/334 (6%) Query: 4 QSLPDTTTPKRRFRWPTGMPQLVALLLVLLVDSLV-APHFWQVVLQDGRLFGSPIDILNR 62 Q+ T +RF G VA L L++ ++V P+F + + L + Sbjct: 7 QATAGTVPSGKRFFTLAGRYGTVAAFLALILFNVVFTPNFLSLQTLNVNL--------TQ 58 Query: 63 AAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPI----------VLL 112 A + ++AIGMTLVIATGGIDLSVG++MAI GA A M G P+ +L Sbjct: 59 VATIVIVAIGMTLVIATGGIDLSVGSLMAIGGAL-APMIFMGTLFPVSSMPVAVALAFVL 117 Query: 113 SALGTGILAGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGS 172 + TG+L GL+NG+LV IQP +ATL+L +AGRG+AQ++T G + F + + Sbjct: 118 PVVATGLL-GLFNGLLVTRFAIQPIIATLVLFIAGRGIAQVMTNGNLQVFRNEGFQFIAL 176 Query: 173 GSLLFLPTPVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVL 232 G + +P VI+ + + W R T G + AVG N +A++ G+ + +L Y++ Sbjct: 177 GRVAGIPAQVILMIAIAAIAWAAIRYTVFGRQVIAVGGNEKASRLTGIPVHRVKLLVYMI 236 Query: 233 SGLCAAIAGIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALII 292 SG A +AG+IV A +DAN GL +ELDAI AV +GG L GGR N++ +V+GAL+I Sbjct: 237 SGALAGVAGLIVVARNSASDANLVGLGMELDAIAAVAVGGTLLTGGRANIVGTVIGALVI 296 Query: 293 QGMNTGILLSGFPPEMNQVVKAVVVLCVLIVQSQ 326 Q + +L +G P +VKA ++L + +Q + Sbjct: 297 QLVRYTLLANGVPDAAALIVKAALILLAVFIQQR 330 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 334 Length adjustment: 28 Effective length of query: 313 Effective length of database: 306 Effective search space: 95778 Effective search space used: 95778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory