Align galactaro-1,5-lactonase (characterized)
to candidate SMa0717 SMa0717 hypothetical protein
Query= reanno::WCS417:GFF3393 (291 letters) >FitnessBrowser__Smeli:SMa0717 Length = 569 Score = 192 bits (488), Expect = 1e-53 Identities = 115/283 (40%), Positives = 152/283 (53%), Gaps = 14/283 (4%) Query: 13 VGECPVWVPGENALYWVDIPKGGLQRWSAATGHVAAWTAPQMLACIARTDAGNWVAGMET 72 +GE PVWV E LYWVDI + R+ TG + ++++ + T + + Sbjct: 293 LGEAPVWVEREKRLYWVDILHPAVHRFDPVTGKNESCNVAKLVSAVLPTRNEGLIVASQD 352 Query: 73 GFFQLTPHNDGSL-DTTLLAAVEHPRQDMRLNDGRCDRQGRFWAGSMVLNMGLNAAEGTL 131 G H D D A E + RLND + D GR W GSM L++ + G+L Sbjct: 353 G----VEHFDFDRGDFNPFAEPEPGLPENRLNDAKVDPSGRLWVGSMRLDV--SRPTGSL 406 Query: 132 YRYTSGAAPHAQLDGFITLNGLAFSPDGRTMYASDSHPLVQQIWAFDYDIDTGTPSNRRV 191 YR TS GF NGLA+SPD T Y D+ P + I+A+D+D G+ +NRRV Sbjct: 407 YRLTSAGEVTRAGSGFTVANGLAWSPDSSTFYFVDTVPGI--IYAYDFDAREGSIANRRV 464 Query: 192 FVDMHKHLGRPDGAAVDADGCYWICANDAGLIHRFSPDGRLDRSLTVPVKKPTMCAFGGS 251 FV + + GRPDG AVDADG W D ++R+ PDGRLDR++ +PV +PT AFGG Sbjct: 465 FVTVPEAEGRPDGLAVDADGGVWCAIWDGWRVNRYRPDGRLDRAVELPVPRPTSVAFGGD 524 Query: 252 RLDTLFVTSIR-----DDQSEQSLSGGVFALNPGVVGLPEPTF 289 L TLF+TS R +E LSGG+FA NPG GLP F Sbjct: 525 ELATLFITSARTRLPASTLTEAPLSGGIFACNPGARGLPTSLF 567 Lambda K H 0.321 0.137 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 569 Length adjustment: 31 Effective length of query: 260 Effective length of database: 538 Effective search space: 139880 Effective search space used: 139880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory