Align ABC transporter for D-glucosamine, periplasmic substrate-binding component (characterized)
to candidate SM_b21135 SM_b21135 amino acid ABC transporter substrate-binding protein
Query= reanno::pseudo3_N2E3:AO353_21710 (282 letters) >FitnessBrowser__Smeli:SM_b21135 Length = 280 Score = 396 bits (1017), Expect = e-115 Identities = 190/279 (68%), Positives = 226/279 (81%), Gaps = 1/279 (0%) Query: 5 LSLFT-ACVFLFAATASAVGIAQAADSRLDNVLKRGHLIVGTGSTNAPWHFQGADGKLQG 63 +S FT A F+ A A+ AQ A S+LD VL RGHLI+GTGSTNAPWHF+ A+ KLQG Sbjct: 2 ISRFTVAASFVAAVLAAMPAQAQQASSKLDEVLSRGHLILGTGSTNAPWHFKSAEDKLQG 61 Query: 64 FDIDIGRMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVAFTL 123 FD+D+GR++AK LF DP K+EFV QSSDARIPN+ T KVD++CQF+TVT RAQQ+AFT+ Sbjct: 62 FDVDMGRIIAKALFGDPEKIEFVNQSSDARIPNITTGKVDITCQFMTVTGERAQQIAFTI 121 Query: 124 PYYREGVGLLLPANSKYKEIEDLKAAGDSVTVAVLQNVYAEELVHQALPKAKVDQYDSVD 183 PYYREGVGL+L A+ KY + E LKAAG SVT++VLQNVYAE++VH ALP+A VDQY+SVD Sbjct: 122 PYYREGVGLMLKADGKYADYEALKAAGSSVTISVLQNVYAEDMVHAALPEATVDQYESVD 181 Query: 184 LMYQAVNSGRADTAATDQSSVKYLMVQNPGRYRSPTYAWSPQTYACAVKRGDQDWLNFVN 243 L+YQA+ SGRAD AATDQSS+ + M QN GRY+ Y W+PQTYAC V+RGDQDWLNFVN Sbjct: 182 LIYQALESGRADAAATDQSSLAWYMTQNSGRYKDAGYGWNPQTYACGVRRGDQDWLNFVN 241 Query: 244 TVLHEAMTGVEFPTYAASFKQWFGVDLPSPAIGFPVEFK 282 T LHEAMTGVEF YA SFK WFG DL P IGFP+E+K Sbjct: 242 TALHEAMTGVEFDFYAKSFKTWFGKDLTPPHIGFPIEYK 280 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 280 Length adjustment: 26 Effective length of query: 256 Effective length of database: 254 Effective search space: 65024 Effective search space used: 65024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory