Align ABC transporter for D-Glucosamine, periplasmic substrate-binding component (characterized)
to candidate SMa0495 SMa0495 ABC transporter substrate-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00480 (282 letters) >FitnessBrowser__Smeli:SMa0495 Length = 272 Score = 82.0 bits (201), Expect = 1e-20 Identities = 56/182 (30%), Positives = 97/182 (53%), Gaps = 11/182 (6%) Query: 41 LIVGTGSTNAPWHFQGADGKLQGFDIDIARMVAKGLFNDPEKVEFVVQSSDARIPNLLTD 100 L VG T AP++++ +DGKL+G+D+D+A+ +++ + D E+V Q D IP LL + Sbjct: 30 LRVGMECTYAPFNYRTSDGKLEGYDVDVAKGISEIIGVD---FEYVCQEWDGMIPALLAN 86 Query: 101 KVDMSCQFITVTASRAQQVAFTLPYYREGVGLLL-PANSKYKEIED----LKAAGDDVTV 155 K D+ +++T R +Q+ F+ P YR VG ++ P K +D + D + + Sbjct: 87 KFDLIIASMSITDKRKEQIDFSSP-YRNSVGRIVGPVGKDLKLFDDKGQPVVGNFDGLRI 145 Query: 156 AVLQNVYAEELVHQALPKAKVDQYDSVDLMYQAVNSGRADAAATD--QSSVKYLMVQNPG 213 V + E LPKA + YDS + MY + +GR D T+ ++ + +L + G Sbjct: 146 GVERASTYFEWFSAKLPKADLVLYDSNEAMYLDLKNGRVDVIMTNPMKAHLSFLSGEGKG 205 Query: 214 RY 215 +Y Sbjct: 206 KY 207 Lambda K H 0.319 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 272 Length adjustment: 25 Effective length of query: 257 Effective length of database: 247 Effective search space: 63479 Effective search space used: 63479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory