Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate SM_b20326 SM_b20326 trehalosemaltose transporter permease
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__Smeli:SM_b20326 Length = 328 Score = 203 bits (517), Expect = 4e-57 Identities = 108/293 (36%), Positives = 170/293 (58%), Gaps = 18/293 (6%) Query: 10 AWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGG-FVGTANYIKML----GGSNF 64 AWL + P +V+ V GWPL+ T+ SFT+A L G FVG ANY+ + G + + Sbjct: 31 AWLFLAPTFLVLALVAGWPLIRTIYFSFTNASLTNLSGAEFVGFANYLSWITLKSGRTIY 90 Query: 65 QRALVTTTW---------FAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPT 115 + L W F V+SV+ E LG++ AL+LN QF GR +RA +++PWA+PT Sbjct: 91 RGLLADPAWWNAVWNTLKFTVLSVSIETALGLIVALVLNAQFPGRGLVRAAILIPWAIPT 150 Query: 116 VVNATLWRLIYNPEYGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALI 175 +V+A +W + N ++G LN L LGL+ +W P TA+ A ++ D WK P +AL+ Sbjct: 151 IVSAKMWAWMLNDQFGILNDMLIGLGLIGEKIAWTASPDTAMIAELIVDVWKTTPFMALL 210 Query: 176 ALAALQAVPRDITAASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVM 235 LA LQ VP DI A+ +DG P F V +P + L+VA++ R ++A ++FD+I+V+ Sbjct: 211 ILAGLQMVPGDIYEAAKIDGVHPVRVFWRVTLPLIRPALMVAVIFRMLDALRIFDLIYVL 270 Query: 236 TRGGPANS-TRTLSILVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALLR 287 T P N+ T+T+S++ + F F + GA+ + ++ L++ + Y L R Sbjct: 271 T---PNNAQTKTMSVMARENLFDFDKFAYGAAASTMLFLIIATITILYMWLGR 320 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 328 Length adjustment: 27 Effective length of query: 266 Effective length of database: 301 Effective search space: 80066 Effective search space used: 80066 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory