Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate SM_b21149 SM_b21149 sugar uptake ABC transporter permease
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__Smeli:SM_b21149 Length = 294 Score = 202 bits (513), Expect = 1e-56 Identities = 106/281 (37%), Positives = 161/281 (57%), Gaps = 2/281 (0%) Query: 10 AWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGGFVGTANYIKMLGGSNFQRALV 69 AW+L+LP + +T ++ +PLVDT LSFTDA L T +VGTANY K+ + + L Sbjct: 11 AWVLLLPAVFYVTVIVAYPLVDTFVLSFTDASLKKTTK-WVGTANYDKIFNATFAEVILR 69 Query: 70 TTTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNPE 129 T W A SV +M++G A++LN GR R L + PW +P + +W +YN + Sbjct: 70 TFVWTA-FSVTIKMIIGTFGAVMLNAAVPGRALFRVLTMPPWIVPMAIGIFMWGWMYNGQ 128 Query: 130 YGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDITA 189 +G ++ L GL+D ++L TA A IV D W PLV L LA++QA+P+D+ Sbjct: 129 FGMISGTLQNWGLVDGPVAFLAHGSTAFWATIVTDVWIGVPLVTLYMLASMQAIPQDLYE 188 Query: 190 ASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLSI 249 A+ DGAG F RFR + +P L ++ +L I F FDIIW++T+GGP T T+ I Sbjct: 189 AAWTDGAGRFYRFRRITLPLLVPSMITMSMLSLIATFNSFDIIWILTQGGPNGDTTTMII 248 Query: 250 LVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALLRKAA 290 Y+ A ++ G GA+ A+++ + ++I AY + + A Sbjct: 249 DTYRTAIGSKKYGEGAARAVLICIFLSIFCIAYFRVTHRLA 289 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 294 Length adjustment: 26 Effective length of query: 267 Effective length of database: 268 Effective search space: 71556 Effective search space used: 71556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory