Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 1 (characterized)
to candidate SMc02472 SMc02472 ABC transporter permease
Query= reanno::Smeli:SMc02872 (315 letters) >FitnessBrowser__Smeli:SMc02472 Length = 312 Score = 142 bits (358), Expect = 1e-38 Identities = 98/312 (31%), Positives = 159/312 (50%), Gaps = 19/312 (6%) Query: 4 REITTYVTEIKRPRRWHILVFLLPALVVYTAVMILPLFETLRQSFY--NTVDGQLTFVGL 61 R+ Y + R R +++FL PAL+++T +ILP+ E S Y N FVGL Sbjct: 17 RKNVRYKSPTVRGRLPVLILFLPPALLLFTVFVILPMGEAAWYSLYRWNGYGTPTQFVGL 76 Query: 62 GNFKVLFGDPRWAADFWNALKNNFVFFLIHMAVQNPIGIALAAMLSVPKLRFGAFYRTAI 121 NF+VLF + A F AL NN + L+ + +Q P+ + LA ML+ ++ +R Sbjct: 77 RNFEVLFNN----AAFSRALINNGIIILVSVLLQIPLALWLAMMLA-HRIAGVVAFRLIF 131 Query: 122 FLPTLLSFVIVGFIWKLILSPIWGVAPYLLDTVGLRSLFGPWLGKPDTALIAVSLISVWQ 181 FLP +L+ V G IW+ + +G+ + G+ + + L A+ AV + +W+ Sbjct: 132 FLPYVLADVAAGLIWRFVYDGDYGLVAAIAGFFGVATPYV--LADRSLAIYAVLAVIIWK 189 Query: 182 YIGIPMMLIYAALLNIPDEVTEAAELDGVTGWSQFWKIKLPLILPAIGIVSILTFVGNFN 241 Y G MML A L + V EAAE+DG TGW +F + LPL+ + + +G+ Sbjct: 190 YFGFHMMLFIAGLQAVDRSVLEAAEIDGATGWQKFRYVTLPLLGSTVRLSIFFAVIGSLQ 249 Query: 242 AFDLIYTVQGALAGPDKSTDILGTLLYRTFFGFQLQLGDRSMGATIAAIMFLIILAGVAL 301 FDL+ + G GP ST + T LY T+ ++Q+G +G+ + ++F+I + Sbjct: 250 LFDLVMPLTG--GGPSNSTQTMVTFLY-TYGVTRMQVG---LGSAVGVVLFVICVT---- 299 Query: 302 YLFGIQRRMRRY 313 FG +R R+ Sbjct: 300 LAFGYKRIFMRH 311 Lambda K H 0.331 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 312 Length adjustment: 27 Effective length of query: 288 Effective length of database: 285 Effective search space: 82080 Effective search space used: 82080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory