Align Glucosamine kinase GspK; GlcN kinase; EC 2.7.1.8 (characterized)
to candidate SMc02875 SMc02875 hypothetical protein
Query= SwissProt::Q9KUA9 (294 letters) >FitnessBrowser__Smeli:SMc02875 Length = 294 Score = 187 bits (475), Expect = 2e-52 Identities = 105/280 (37%), Positives = 162/280 (57%), Gaps = 1/280 (0%) Query: 3 YYVGIDGGGTSCRARIRNQQGEWVGEAKSGSANIMLGVEVALRSVVDAITQAAEQGGLSP 62 Y +GIDGGGTSCRA + G +G K+G+ANI+ E AL+++ DA A GL P Sbjct: 4 YLIGIDGGGTSCRAAVAALDGRILGRGKAGAANILTDPETALQNITDAARDAFGDAGLDP 63 Query: 63 DDFPSMHVGLALAGAEQKEAWHAFMQQAHPFASITLNTDAYGACLGAHLGEEGAIMIAGT 122 + + +AG +A H ++++ PFA + +D A GA +GA+ I GT Sbjct: 64 AGIGASRAIVGVAGHNVGDAVH-YVKRRLPFAQADIESDGLIALQGALGDGDGAVAILGT 122 Query: 123 GSCGILLKGGKQYVVGGREFPISDQGSGAVMGLRLIQQVLLAQDGIRPHTPLCDVVMNHF 182 G+ I +G + VGG F I D GSGA +G L+Q+ LLA DGI + + D V+ F Sbjct: 123 GTIYIARRGDEVSYVGGWGFTIGDHGSGARIGHALLQESLLAYDGIHQGSGVTDAVLAEF 182 Query: 183 NHDIDSIVAWSKTALPRDYGQFSPQIFSHAYCGDPLAIELLKQTAADIEMFLIALHHKGA 242 N D IV +++ A P ++G+++P++F A GDP+AI LLK AA ++ L + +G+ Sbjct: 183 NDDPRDIVDFARLAKPGEFGRYAPRVFEFAERGDPVAISLLKAAAATVDEALDVVVSRGS 242 Query: 243 ERICLMGSIAERIQDWLSPPVQQWIVKPQSDAIEGALMFA 282 E++CL+G +A + WL+ Q V+ ++DA+ GA+ A Sbjct: 243 EKLCLLGGLAPLYRRWLADRHQPRFVEARADALTGAVALA 282 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory