Align NgcG, component of N-Acetylglucosamine/N,N'-diacetyl chitobiose porter (NgcK (C) not identified) (characterized)
to candidate SMc02871 SMc02871 ABC transporter permease
Query= TCDB::Q8RJU8 (307 letters) >FitnessBrowser__Smeli:SMc02871 Length = 279 Score = 154 bits (389), Expect = 2e-42 Identities = 84/267 (31%), Positives = 141/267 (52%), Gaps = 4/267 (1%) Query: 43 HGILVLWAFMVVLPLLWAVMTSFKDDASIFGSPWSLPDKLHFD--NWSRAWTEAHMGDYF 100 H L+ + + + P+ ++ SFK +IF P ++P F + + YF Sbjct: 15 HAALIAYTLIALFPVFLTIVNSFKSRNAIFREPLAVPTPETFSLIGYETVLKQGDFIGYF 74 Query: 101 LNTVLVVGGSLIGTLVLGSMAAYVLARFDFPGNRFIYYLFIGGMSFPIMLALVPLFYVVN 160 N+++V S+ L+ G+MAA+ L+ + F GN + G+ PI L V + + Sbjct: 75 QNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGIMIPIRLGTVAILQGMV 134 Query: 161 NMGLLNTLHGLILVYIAYSLPFTVFFLTAFFRTLPSSVAEAAFVDGASHTRTFFQIMLPM 220 GL+NTL LILVY A LP VF L+ F RT+ + A +DG S F +++LP+ Sbjct: 135 ATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDGLSEYAIFLRLVLPL 194 Query: 221 AKPGLISVGIFNFLGQWNQYMLPTVLNTDPDKRVLTQGLVQLAVSQGYKGDWSGLFAGLV 280 +P + +V +F + WN P +L + +T G Q+ + Q + +W+ + + L Sbjct: 195 IRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLG-SQIFIGQ-FVTNWNAVLSALS 252 Query: 281 MAMLPVLAAYIIFQRQVVQGLTAGALK 307 +A+ PVL Y+IF RQ+++G+TAGA+K Sbjct: 253 LAIFPVLVLYVIFSRQLIRGITAGAVK 279 Lambda K H 0.326 0.141 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 279 Length adjustment: 26 Effective length of query: 281 Effective length of database: 253 Effective search space: 71093 Effective search space used: 71093 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory