GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glk in Sinorhizobium meliloti 1021

Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate SMc02835 SMc02835 glucokinase

Query= curated2:B9JYQ5
         (340 letters)



>FitnessBrowser__Smeli:SMc02835
          Length = 339

 Score =  457 bits (1177), Expect = e-133
 Identities = 225/338 (66%), Positives = 268/338 (79%), Gaps = 1/338 (0%)

Query: 4   PHDNDH-MPFPVLVGDIGGTNARFWILMDAHAAPKEFANIHTADFPTIDQAIQDCILDKS 62
           P+ ++H  PFP+L+GDIGGTNARF +L DA+  PK+ A I T DF TI++A+Q  ILDK+
Sbjct: 2   PNASEHSFPFPILIGDIGGTNARFALLTDAYGEPKQLAPIRTGDFATIEEAMQKGILDKT 61

Query: 63  GFQPRSAILAVAGPIKDDEIPLTNCPWVIRPKAMIADLGFDDVLVVNDFEAQALAAASLG 122
             QPRSAILAVAGPIK DEIPLTN  WVIRPK M+A LG +DVLV+NDFEAQALA A+  
Sbjct: 62  SVQPRSAILAVAGPIKGDEIPLTNAGWVIRPKDMLAGLGLEDVLVINDFEAQALAIAAPA 121

Query: 123 RNDREPIGPLTETSLNSRVILGPGTGLGVGGLLYTHHTWFPVPGEGGHVDIGPRSDRDWQ 182
             D   IG       +SRV+LGPGTGLGV GL+Y  HTW PVPGEGGHVDIGPR++RD++
Sbjct: 122 DQDVVQIGGGAVRPFHSRVVLGPGTGLGVAGLVYAQHTWIPVPGEGGHVDIGPRTERDFR 181

Query: 183 IFPHIERIEGRISGEQILCGRGILHLYNAICAADGIEPVWTDPADVTQHALKGNDPVCVE 242
           I+P +E IEGR++GEQILCGRGI++LY A+CAA+G E V  D A VT  AL G D   VE
Sbjct: 182 IWPFLEPIEGRMAGEQILCGRGIMNLYRAVCAANGEEAVLADQAAVTTSALSGADAAAVE 241

Query: 243 TMTLFVTYLGRIAGDMALVFMARGGVFLSGGISQKIIPLLKSPVFRAAFEDKAPHTEMMK 302
           T++LF TYLGR+AGDMAL+FMARGGVFL+GGISQKI+P L  P FRAAFEDKAPH+ +M+
Sbjct: 242 TVSLFATYLGRVAGDMALIFMARGGVFLAGGISQKILPALTKPEFRAAFEDKAPHSALMR 301

Query: 303 TIPTFVAIHPQAALSGLAAYARTPSSYGVKHEGRRWQR 340
           TIPTF  IHP AALSGLAA+ARTP  +GV  EGRRW+R
Sbjct: 302 TIPTFAVIHPMAALSGLAAFARTPRDFGVAMEGRRWRR 339


Lambda     K      H
   0.322    0.140    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 440
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 340
Length of database: 339
Length adjustment: 28
Effective length of query: 312
Effective length of database: 311
Effective search space:    97032
Effective search space used:    97032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)

Align candidate SMc02835 SMc02835 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.28929.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.28929.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.