Align tartronate semialdehyde reductase 2 (characterized)
to candidate SM_b20679 SM_b20679 tartronate semialdehyde reductase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__Smeli:SM_b20679 Length = 294 Score = 380 bits (977), Expect = e-110 Identities = 195/291 (67%), Positives = 233/291 (80%), Gaps = 1/291 (0%) Query: 3 LGFIGLGIMGTPMAINLARAGHQLHVTT-IGPVADELLSLGAVSVETARQVTEASDIIFI 61 +GFIGLGIMGTPMA +L AGH++ + + P EL+ G VET + + E D I + Sbjct: 4 IGFIGLGIMGTPMARHLQDAGHEIITSKFVIPPRQELVENGLEIVETPKALAETVDTIIL 63 Query: 62 MVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVSG 121 M+PDTP+V++VLFGENG +GK ++DMSSISPIETK FA++V E G +Y+DAPVSG Sbjct: 64 MLPDTPEVKDVLFGENGVYYGLGEGKLVIDMSSISPIETKEFAKKVRETGAEYIDAPVSG 123 Query: 122 GEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNIE 181 GE+GA+ +LSIM GG + FER PLF+L+GKNITLVG GDGQ KVANQIIVAL IE Sbjct: 124 GEVGAKNASLSIMAGGKPSSFERALPLFKLMGKNITLVGDCGDGQVTKVANQIIVALTIE 183 Query: 182 AVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLNL 241 AVSEAL+FASKAGADP RVR+ALMGGFASSRILEVHG+RMIKRTF PGF+I+LHQKDLNL Sbjct: 184 AVSEALVFASKAGADPARVREALMGGFASSRILEVHGDRMIKRTFEPGFRISLHQKDLNL 243 Query: 242 ALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALELMANHKLA 292 ALQ AK+L ++LPNTA QELFN CAANG S LDHS LV+ALE MANH++A Sbjct: 244 ALQGAKSLGISLPNTAATQELFNNCAANGDSGLDHSGLVRALERMANHEVA 294 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 294 Length adjustment: 26 Effective length of query: 266 Effective length of database: 268 Effective search space: 71288 Effective search space used: 71288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate SM_b20679 SM_b20679 (tartronate semialdehyde reductase)
to HMM TIGR01505 (2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01505.hmm # target sequence database: /tmp/gapView.5329.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01505 [M=291] Accession: TIGR01505 Description: tartro_sem_red: 2-hydroxy-3-oxopropionate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-128 412.8 1.0 4.1e-128 412.6 1.0 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20679 SM_b20679 tartronate semialdehyd Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20679 SM_b20679 tartronate semialdehyde reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.6 1.0 4.1e-128 4.1e-128 2 291 .] 4 293 .. 3 293 .. 0.99 Alignments for each domain: == domain 1 score: 412.6 bits; conditional E-value: 4.1e-128 TIGR01505 2 vgfiGlGimGkPmsknllkaGyqlvvatleqealdellaaGaesaetakevvedadvivtmvPdsPqveevalG 75 +gfiGlGimG+Pm++ l aG+++ + + + +el+ G e +et k+++e d i+ m+Pd+P+v++v++G lcl|FitnessBrowser__Smeli:SM_b20679 4 IGFIGLGIMGTPMARHLQDAGHEIITSKFVIPPRQELVENGLEIVETPKALAETVDTIILMLPDTPEVKDVLFG 77 79****************************9******************************************* PP TIGR01505 76 enGileaakkGkvlvdmssiaPleskelakavkekGidvldaPvsGGeagaiegtlsimvGGdkavfdkvkpll 149 enG+ + +Gk+++dmssi+P+e+ke+ak+v+e G +++daPvsGGe+ga+++ lsim GG+ + f+++ pl+ lcl|FitnessBrowser__Smeli:SM_b20679 78 ENGVYYGLGEGKLVIDMSSISPIETKEFAKKVRETGAEYIDAPVSGGEVGAKNASLSIMAGGKPSSFERALPLF 151 ************************************************************************** PP TIGR01505 150 ealgksivlvGenGaGqtvkvanqvivalnieavsealvlaekaGvdpkavlqalrGGlagstvleakkerlld 223 +++gk+i+lvG+ G+Gq++kvanq+ival ieavsealv+a+kaG+dp +v++al+GG+a+s++le++++r+++ lcl|FitnessBrowser__Smeli:SM_b20679 152 KLMGKNITLVGDCGDGQVTKVANQIIVALTIEAVSEALVFASKAGADPARVREALMGGFASSRILEVHGDRMIK 225 ************************************************************************** PP TIGR01505 224 rdfkPGfridlhqkdlalaldaakavgaalPvtavvaellaalradGdgtldhsalvraleklakdkv 291 r+f+PGfri lhqkdl+lal+ ak++g++lP+ta+ +el++ ++a+Gd++ldhs lvrale++a+++v lcl|FitnessBrowser__Smeli:SM_b20679 226 RTFEPGFRISLHQKDLNLALQGAKSLGISLPNTAATQELFNNCAANGDSGLDHSGLVRALERMANHEV 293 ******************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (291 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.71 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory