Align tartronate semialdehyde reductase 2 (characterized)
to candidate SMa0237 SMa0237 dehydrogenase
Query= ecocyc::G6278-MONOMER (292 letters) >FitnessBrowser__Smeli:SMa0237 Length = 293 Score = 202 bits (514), Expect = 7e-57 Identities = 121/284 (42%), Positives = 165/284 (58%), Gaps = 3/284 (1%) Query: 2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPV-ADELLSLGAVSVETARQVTEASDIIF 60 K+ F+G G+MG PMA L AG + V A+ L + GA + + I+F Sbjct: 6 KIAFLGTGLMGAPMARRLLGAGFSVTVWNRDAAKAEPLAADGADIAASPADAVAGAAIVF 65 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 M+ + V EVLF E G + +G+ +VD SSI+P + AR++ E G +LDAPVS Sbjct: 66 TMLTNGQAVSEVLF-ERGVADSLAEGRIVVDCSSIAPQIAREHARRLAEKGIRHLDAPVS 124 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNGDGQTCKVANQIIVALNI 180 GG +GA GTL+IM GGD A E +K +F +LG+ +T VG +G GQ CK+ANQ IVA+ I Sbjct: 125 GGVVGAAAGTLAIMAGGDGAAVESLKEVFAVLGR-VTHVGPSGAGQVCKLANQQIVAVTI 183 Query: 181 EAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDLN 240 AV+EA++ GA R A+ GGFA SRILE+HG RM++R F PG KDLN Sbjct: 184 GAVAEAMVLVEAGGASRAAFRDAIRGGFAESRILELHGARMVERNFAPGGASNNQLKDLN 243 Query: 241 LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQALE 284 + A L+L LP T ++ F +GG + DHS L+ LE Sbjct: 244 AVMAMADELSLELPLTRQVRQEFADFVESGGGEQDHSGLLLQLE 287 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 293 Length adjustment: 26 Effective length of query: 266 Effective length of database: 267 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory