Align 2-hydroxy-3-oxopropionate reductase; EC 1.1.1.60; Tartronate semialdehyde reductase; TSAR (uncharacterized)
to candidate SMc00274 SMc00274 oxidoreductase
Query= curated2:P77161 (292 letters) >FitnessBrowser__Smeli:SMc00274 Length = 295 Score = 147 bits (372), Expect = 2e-40 Identities = 90/283 (31%), Positives = 145/283 (51%), Gaps = 3/283 (1%) Query: 2 KLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSL-GAVSVETARQVTEASDIIF 60 ++ F+GLG MG PMA NL RAGH + + A E L+ G + + +D++ Sbjct: 6 RVAFVGLGSMGLPMAENLIRAGHAVRGFDVRAAAMETLAATGGIRSANPAEACSGADVLV 65 Query: 61 IMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFARQVNELGGDYLDAPVS 120 +MV + Q VL E+G + +G I M++ P E KR A +V G +D PVS Sbjct: 66 LMVVNAEQARSVLL-ESGALSSLPQGAHICLMATCPPDEVKRLADEVEASGRVLVDCPVS 124 Query: 121 GGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGN-GDGQTCKVANQIIVALN 179 GG +GA+ G L+IMVG E + V P+ + +G + G G G K NQ++ ++ Sbjct: 125 GGVVGAKAGALTIMVGAPEKAYHAVVPVLQAMGDKVFHCGPEQGQGAVVKAINQLLCGVH 184 Query: 180 IEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMIKRTFNPGFKIALHQKDL 239 + +EAL KAG D + + + ASS +L+ G RMI +T + + KDL Sbjct: 185 LATAAEALALGEKAGVDAATLLEIVSNSAASSWMLKDRGPRMITKTPPVTSAVDIFVKDL 244 Query: 240 NLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQA 282 +AL + +++++ LP A ++F + +G D S ++ A Sbjct: 245 GIALATGRSVSMALPLAAAAHQMFLAESGSGNGLEDDSQVIAA 287 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 295 Length adjustment: 26 Effective length of query: 266 Effective length of database: 269 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory