Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate SMc02164 SMc02164 fructokinase
Query= SwissProt::Q53W83 (309 letters) >FitnessBrowser__Smeli:SMc02164 Length = 308 Score = 96.3 bits (238), Expect = 8e-25 Identities = 98/315 (31%), Positives = 141/315 (44%), Gaps = 31/315 (9%) Query: 4 VVTAGEPLVALVPQEPGHLRGKRLLEVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGA 63 +V GE L+ ++P+E G+ Y GGA N AVAL RLGV GF + +D G Sbjct: 2 IVCCGEALIDMLPRET--TAGESAFAPYAGGAIFNTAVALGRLGVPTGFFTGLSDDMFGD 59 Query: 64 MVEERLRAEGVDLTHFRRAPGFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDP--D 121 ++ L+A VD P T L + + G ++ + +AG + D Sbjct: 60 ILRATLKAANVDFAPCATLPLHTTLAFVKLVD-GHASYAFFDENTAGRMITAEHLPALGD 118 Query: 122 YLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEAR-GFL 180 + E + F +S I A L A E KR +S D N R EA G + Sbjct: 119 FCEALHFGAISLIPEPCGSTYEA--LMAREHEKRV---ISFDPNIRPGFIKDREAHVGRM 173 Query: 181 ERALPGVDLLFLSEEEAELLFGRVEEALRALSA------PEVVL-KRGAKGAWAFVDGRR 233 R D++ S+E+ L + +E + AL+A P++VL RGA GA + +G + Sbjct: 174 NRMAAMSDIVKFSDED--LAWFGMEGSHDALAAEWLKRGPKLVLITRGADGAVGYTNGHK 231 Query: 234 VEGSAFAVEAVDPVGAGDAFAAGYLAGAVW---------GLPVEERLRLANLLGASVAAS 284 VE ++ VE VD VGAGD F AG LA + +E +R A L A AA Sbjct: 232 VEVASERVEVVDTVGAGDTFDAGVLASLKFNNLLTKERVASLTDEAIRQALTLAAKAAAV 291 Query: 285 RGDHEGA--PYREDL 297 GA P+R +L Sbjct: 292 TVSRAGANPPWRHEL 306 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 308 Length adjustment: 27 Effective length of query: 282 Effective length of database: 281 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory