Align 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxy-D-gluconate kinase; KDG kinase; EC 2.7.1.45 (characterized)
to candidate SMc02875 SMc02875 hypothetical protein
Query= SwissProt::Q9HLV3 (336 letters) >FitnessBrowser__Smeli:SMc02875 Length = 294 Score = 94.7 bits (234), Expect = 2e-24 Identities = 82/257 (31%), Positives = 124/257 (48%), Gaps = 16/257 (6%) Query: 7 ILGVDGGSTKTLAIVFDERSERIMGVGISGPSNFTNAPRETAESNISDAVRKACSEAGTD 66 ++G+DGG T A V RI+G G +G +N P ETA NI+DA R A +AG D Sbjct: 5 LIGIDGGGTSCRAAVA-ALDGRILGRGKAGAANILTDP-ETALQNITDAARDAFGDAGLD 62 Query: 67 LDGIGIR--VFGLAG--IGDSREATELGKDIVRSIVGHADVYSDGLGAYKFANLNDDGVV 122 GIG + G+AG +GD+ + R AD+ SDGL A + A + DG V Sbjct: 63 PAGIGASRAIVGVAGHNVGDAVHYVKR-----RLPFAQADIESDGLIALQGALGDGDGAV 117 Query: 123 FAPGTGSVGFIKNGSDPERFGGWGWFIGDEASASWMAKQAILFAEREHDGIAE-TGFLDV 181 GTG++ + G + GGWG+ IGD S + + + + +DGI + +G D Sbjct: 118 AILGTGTIYIARRGDEVSYVGGWGFTIGDHGSGARIGHALLQESLLAYDGIHQGSGVTDA 177 Query: 182 VRRYFGMDLYETVYAISKEKIAKRVVAALAPQVSAMARSGNRYAISIFEESSSYIADLLN 241 V F D + V K + AP+V A G+ AIS+ + +++ + + L+ Sbjct: 178 VLAEFNDDPRDIVDFARLAKPGE--FGRYAPRVFEFAERGDPVAISLLKAAAATVDEALD 235 Query: 242 AKSRIFGRSGKYSVLGG 258 + S K +LGG Sbjct: 236 VV--VSRGSEKLCLLGG 250 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 294 Length adjustment: 27 Effective length of query: 309 Effective length of database: 267 Effective search space: 82503 Effective search space used: 82503 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory