Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate SMc03118 SMc03118 ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__Smeli:SMc03118 Length = 295 Score = 141 bits (355), Expect = 2e-38 Identities = 91/296 (30%), Positives = 157/296 (53%), Gaps = 13/296 (4%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 ++ F+ QLL GL GS Y L+++G +++G++ +INFAHG +MLG F A +L+L+ + Sbjct: 9 LQAFLGQLLIGLINGSFYALLSLGLAIIFGLLRVINFAHGAQYMLGAFMA---WLLLSYL 65 Query: 61 FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQ 120 G A L++A L+ L IER R L L L+ G+++T+ + Sbjct: 66 GIGYWPA------LILAPLLVGLIGAVIERTMLRRLYTLDPLYGLLFTFGLALTIEGTFR 119 Query: 121 VTQGPRNKP--IPPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRA 178 G +P P ++ G + + + + +IV + V+ W ++ +T LG RA Sbjct: 120 YLYGASGQPYATPALLMGGANLGFMFLPIYRGWVIVFSLVICLGTWLMIEKTKLGSYLRA 179 Query: 179 TEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAA 238 ++ + G+NV +++T+ +GAALAA+AG + Y V+ G + F Sbjct: 180 ATENPVLVQSFGINVPFLLTLTYGLGAALAAIAGVLAAPIYQVSPLM-GSNIIIVVFAVV 238 Query: 239 VLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGR 294 V+GG+GS+ GA+ G L+G+ E L ++ A ++ F I+A VL+ +P G+ GR Sbjct: 239 VVGGMGSIMGAIVTGYLLGIAEGLTKVFYPEA-SNIVIFVIMAIVLLLRPAGLFGR 293 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 295 Length adjustment: 26 Effective length of query: 274 Effective length of database: 269 Effective search space: 73706 Effective search space used: 73706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory