Align BztA, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate SMc00676 SMc00676 amino acid-binding periplasmic signal peptide protein
Query= TCDB::Q52663 (338 letters) >FitnessBrowser__Smeli:SMc00676 Length = 331 Score = 348 bits (892), Expect = e-100 Identities = 170/328 (51%), Positives = 223/328 (67%), Gaps = 1/328 (0%) Query: 11 ALAALVAGAASASTLDDVKARGQLICGSNPGLTGFAAPDANGVYQGFDVAVCKAVAAAVL 70 A A L A A+TLD VK RG+L CG + G+ GF+APD G + GFD+ C+AVAAA L Sbjct: 5 ATAFLAGTTAQAATLDVVKQRGELRCGVSQGVLGFSAPDDKGEWSGFDIDFCRAVAAATL 64 Query: 71 GDPMKVKYVPLTGETRFTALASGEVDVLVRNSTWTFSRDTELALDFVAVNYYDGQGFMVN 130 G P KVKYVPL+ + RFTAL SGEVD+L R +TWT SRDT+L + FV VNYYDGQ FMV Sbjct: 65 GSPDKVKYVPLSTKERFTALQSGEVDLLSRQTTWTLSRDTDLGMSFVGVNYYDGQAFMVR 124 Query: 131 KSLGVSSAKELDGATICVQTGTTTEMNLADFFKANNMTYTPVNIADDAEGQQKFAAGACD 190 +GV S KEL GA++C +TGTTTE N+AD+F AN + Y + + Q F +G CD Sbjct: 125 GDIGVKSVKELSGASVCTETGTTTEQNMADYFSANKIEYQVIAFEKADQTIQAFNSGRCD 184 Query: 191 SYTTDASGLASSRATLPNAADIVILPEIISKEPLGPVVRHGDNNWGDIVRWSFYALVAAE 250 Y+TDAS L S R TL + V+LPE+ISKEPLGP VR GD+ W +VRW+ +A++ AE Sbjct: 185 VYSTDASALYSQRLTLNDPDRFVVLPEVISKEPLGPAVRQGDDQWFKVVRWTLFAMIEAE 244 Query: 251 EYGITKANLEEVAASTQNPEIRRLLGLEGDMGKKIGLDNDFAKRAILASGNYGEVFEANI 310 E GIT+ N + S + +R LG++ + GK +GLD +A + + A GNYGE+FE ++ Sbjct: 245 ELGITRENAASLLESGTAAQ-KRFLGIDNEAGKALGLDPKWAYQTVAAVGNYGEIFERHL 303 Query: 311 GASTSIGLARGLNAQWTQGGLMYAPPFR 338 G +++ + RGLN W GGL+YAPP R Sbjct: 304 GKESALRIDRGLNKLWNNGGLIYAPPVR 331 Lambda K H 0.316 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 331 Length adjustment: 28 Effective length of query: 310 Effective length of database: 303 Effective search space: 93930 Effective search space used: 93930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory