Align Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized)
to candidate SMc03865 SMc03865 amino-acid transport system permease ABC transporter protein
Query= TCDB::Q9I403 (248 letters) >FitnessBrowser__Smeli:SMc03865 Length = 273 Score = 117 bits (294), Expect = 2e-31 Identities = 70/224 (31%), Positives = 120/224 (53%), Gaps = 15/224 (6%) Query: 26 IAGLGWTIAIALVGWIIALALGSLLGVMRTVPNRLVSGIATAYVEIFRNVPLLVQLF--- 82 + GLG T+ + LVG+++A LG + +M + ++ IA Y E+ R VP+LV LF Sbjct: 47 LKGLGVTVFVTLVGFVLATVLGLGVALMALSEHVVLRQIARFYTEVIRGVPILVLLFYIA 106 Query: 83 ---------IWYFLVPDLLPEGLQTWFKQDLNPTTSAYLSVVVCLGLFTAARVCEQVRTG 133 + F+ L+ G W + + S ++ L + +A + E R G Sbjct: 107 FVGAPALVTVANFVAAPLISAG---WIEPFVVRDVSLMWRAIMALMIGYSAFIAEVFRAG 163 Query: 134 IQALPYGQTSAARAMGFRLPQIYRHVLLPQAFRIIIPPLTSEFLNIFKNSSVASLIGLME 193 IQ++ GQ AA+A+G Q +R V+ PQA R+I+PPL ++F+ + K+SS+ S++G+ + Sbjct: 164 IQSVDKGQVEAAKALGLSRYQRFRLVVFPQAIRVILPPLGNDFVAMVKDSSLVSVLGVAD 223 Query: 194 LLAQTKQTAEFSANLFEAFTLATLIYFTLNMSLMLIMRLVERKV 237 + K A S FE +++ +Y L + L L +R VER++ Sbjct: 224 ITQMGKVYASGSFRFFETYSIVAYVYLVLTIGLSLALRAVERRL 267 Lambda K H 0.327 0.141 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 273 Length adjustment: 24 Effective length of query: 224 Effective length of database: 249 Effective search space: 55776 Effective search space used: 55776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory