Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate SM_b21095 SM_b21095 amino acid ABC transporter permease
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__Smeli:SM_b21095 Length = 290 Score = 112 bits (281), Expect = 6e-30 Identities = 74/228 (32%), Positives = 127/228 (55%), Gaps = 11/228 (4%) Query: 3 EFDWSSIVPSL--PYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV 60 + +WS + L P +L GL TL +TV A+ +GI+ G ++A+MR+S ++ A Y+ Sbjct: 52 QIEWSYVRDFLFAPAILAGLYNTLLMTVAAMGLGIVLGVVIAIMRISGNPVLSLIAIGYI 111 Query: 61 NVFRSIP-LVMVLLWFYL--IVPGFLQNVLGLSPKNDIRL----ISAMVAFSMFEAAYYS 113 VFR P L+ ++LWF L I P F + GL + + ++A++ + + AY S Sbjct: 112 WVFRGAPALLQLMLWFNLALIFPTF--GIPGLFEFRTVDVMTPFVAAVLGLGISQGAYTS 169 Query: 114 EIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVY 173 E++R+G+ S+ GQ AA +GMT + ++ I+LPQA R MVP + + I + + TSL Sbjct: 170 EVVRSGLLSVDSGQYEAARTIGMTQMKMLRRIVLPQAMRVMVPPVGNEVIGMVKLTSLAS 229 Query: 174 VLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKR 221 V+ ++ A I + +E++L A F Y ++ S+ Y++R Sbjct: 230 VIQYSEILHNAQIIYFANTRVLELLLVASFWYLLVVSVLSIGQHYIER 277 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 290 Length adjustment: 24 Effective length of query: 200 Effective length of database: 266 Effective search space: 53200 Effective search space used: 53200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory