Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate SMc03893 SMc03893 amino-acid transport system permease ABC transporter protein
Query= TCDB::A1VZQ3 (250 letters) >FitnessBrowser__Smeli:SMc03893 Length = 226 Score = 121 bits (304), Expect = 1e-32 Identities = 67/199 (33%), Positives = 113/199 (56%), Gaps = 4/199 (2%) Query: 47 GFIYTLEVSILALLIATIFGTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYA 106 G I+T+ +++L+ + G + V+ A R YV + + PL++Q+F +FY Sbjct: 19 GLIFTIPLTLLSFTLGLALGLVTAVVRLFAPAPFAAVARFYVWVIRGTPLLVQLFVIFYG 78 Query: 107 LPVLGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPRGQFEASASQGFTYIQQMRYII 166 LP +GI LD F ++G GAY SE++R+ I +VPRGQ+EA+ S G ++ Q MR I Sbjct: 79 LPSMGILLDAFPAALIGFTLNIGAYSSEIIRAVISSVPRGQWEAAYSIGMSWSQAMRRTI 138 Query: 167 VPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSADSYAADYGNYAPAYIFAAVLYF 226 +PQ R+ +PP++N ++L+K+TS+ + EL +A A YI AA++Y Sbjct: 139 LPQAGRVAVPPLSNTFISLVKDTSLAAAITVPELFQTAQRIVATSYEPLILYIEAALIYL 198 Query: 227 IICYPLAYFAKAYENKLKK 245 ++ L+ A + KL++ Sbjct: 199 VMSSVLS----ALQGKLEQ 213 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 226 Length adjustment: 23 Effective length of query: 227 Effective length of database: 203 Effective search space: 46081 Effective search space used: 46081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory