Align NAD-dependent glycerol dehydrogenase; Dha-forming NAD-dependent glycerol dehydrogenase; EC 1.1.1.6 (characterized)
to candidate SMc00268 SMc00268 oxidoreductase
Query= SwissProt::Q92EU6 (254 letters) >FitnessBrowser__Smeli:SMc00268 Length = 252 Score = 144 bits (362), Expect = 2e-39 Identities = 89/244 (36%), Positives = 144/244 (59%), Gaps = 10/244 (4%) Query: 17 AVVTGAAS--GIGKAMAELFSEKGAYVVLLDIKE-DVKDVAAQINPSRTLALQVDITKKE 73 AV+TGAAS G+GKA A LF+E GA V +LD+ E D ++ AA + P R + + ++T Sbjct: 11 AVITGAASRRGLGKATARLFAEHGATVAILDLDEADAREAAASLGP-RHVGMACNVTDLA 69 Query: 74 NIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQIIGRE 133 ++ V+ + + +IDIL N+AG+ K ++ E +D +++NL+G+ +Q + Sbjct: 70 SVRTVMDALVSQWGRIDILVNNAGITQPLKIMEIAPENYDAVLDVNLRGTLYCSQAVIPH 129 Query: 134 MIATGGGKIVNMASQASV----IALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNAIS 189 M + GKIVN++S ++ I H Y A+KA ++ +T+ +A E AP N+ VNAI Sbjct: 130 MRSRKQGKIVNLSSVSAQRGGGIFGGPH--YSAAKAGVLGLTKAMARELAPDNVRVNAIC 187 Query: 190 PTVILTELGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENLIIDG 249 P I T++ + E++K IP GR G ++VA CALFL SD ++ +TG + ++G Sbjct: 188 PGFIATDITGGLLTPEKLEEIKAGIPMGRPGTADDVAGCALFLASDLSAYVTGSEVDVNG 247 Query: 250 GYTI 253 G I Sbjct: 248 GSLI 251 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 252 Length adjustment: 24 Effective length of query: 230 Effective length of database: 228 Effective search space: 52440 Effective search space used: 52440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory