Align PTS-dependent dihydroxyacetone kinase 2, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 (characterized)
to candidate SM_b20312 SM_b20312 dihydroxyacetone kinase
Query= SwissProt::Q92EU2 (331 letters) >FitnessBrowser__Smeli:SM_b20312 Length = 695 Score = 315 bits (808), Expect = 2e-90 Identities = 157/333 (47%), Positives = 219/333 (65%), Gaps = 2/333 (0%) Query: 1 MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEEPRVRIIVGGGSGHEP 60 +++ +N+ E VEEML G V A Y+ R +V++ +V +++GGG+GHEP Sbjct: 363 VKKFLNNPNEVVEEMLDGAVKAHEIYLQPINGSHRALVARNGPRPGKVGLVIGGGTGHEP 422 Query: 61 LFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYMYGNYAGDVMNFDMGAE 120 FLGYVGK ADA VGNI +SP P+P +A G+G L++YGNYAGDVMNF+M AE Sbjct: 423 CFLGYVGKGLADAVAVGNIFSSPPPDPIVQCAEAASGGEGVLFVYGNYAGDVMNFEMAAE 482 Query: 121 MAADDGIRVETVLVTDDIYSA--ENVEDRRGVAGDLIVFKAAASAAAKGLDLDAVKQAAE 178 +A + GI+V+TVL TDD+ S+ E+ E RRGVAG+ +FK A +A +GL L+A + Sbjct: 483 IAEEKGIKVKTVLTTDDVASSPVEDREGRRGVAGNFFIFKIAGAACDRGLSLEACEAVTR 542 Query: 179 KANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPGIKRTSIEPADKVVDQI 238 KAN T+++GVAL ++P T + FE+ +MEVGMGIHGEPG+ R I AD++ D I Sbjct: 543 KANLRTYTVGVALEPGSMPQTRRHNFEIGPDDMEVGMGIHGEPGVTRERIRSADEITDSI 602 Query: 239 MGYLIEEMKLTAGEEVHVLINGLGGLPVMDQYICYRRVDEILKEKGVHIHSPLVGNYATS 298 M + +EMK GE V VL+N G P+M+ YI +RRV + L K + I + +G+Y TS Sbjct: 603 MDRIFKEMKTAPGERVAVLVNSFGATPLMELYILFRRVQQRLAAKDILIEANWIGHYCTS 662 Query: 299 MDMIGMSITLVRLDDELKDLLDTPCDTPYFKVD 331 +DM G SIT++ LD EL DLL PC+T + KV+ Sbjct: 663 LDMAGASITILHLDQELSDLLHHPCETAFLKVN 695 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 695 Length adjustment: 33 Effective length of query: 298 Effective length of database: 662 Effective search space: 197276 Effective search space used: 197276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory