Align triokinase (EC 2.7.1.28); glycerone kinase (EC 2.7.1.29); FAD-AMP lyase (cyclizing) (EC 4.6.1.15) (characterized)
to candidate SM_b20312 SM_b20312 dihydroxyacetone kinase
Query= BRENDA::Q3LXA3 (575 letters) >FitnessBrowser__Smeli:SM_b20312 Length = 695 Score = 177 bits (448), Expect = 2e-48 Identities = 111/327 (33%), Positives = 175/327 (53%), Gaps = 10/327 (3%) Query: 4 KKLVNSVAGCADDALAGLVACNP-NLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPA 62 KK +N+ ++ L G V + LQ + G AL + G+V L+ GGG+GHEP Sbjct: 364 KKFLNNPNEVVEEMLDGAVKAHEIYLQPINGSHRALVARNGPRPGKVGLVIGGGTGHEPC 423 Query: 63 HAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAR 122 G++GKG+ V G +F+SP I+ A A +G G L + NY GD +NF +A Sbjct: 424 FLGYVGKGLADAVAVGNIFSSPPPDPIVQC--AEAASGGEGVLFVYGNYAGDVMNFEMAA 481 Query: 123 EQARAEGIPVEMVVIGDDSAFT-VLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQV 181 E A +GI V+ V+ DD A + V + GRRG+ G I K+AGA + G+ LE Sbjct: 482 EIAEEKGIKVKTVLTTDDVASSPVEDREGRRGVAGNFFIFKIAGAACDRGLSLEACEAVT 541 Query: 182 NVVAKAMGTLGVSLSSCSVPGS-KPTFELSADEVELGLGIHGEAGVRRIKMATADEIVKL 240 T+GV+L S+P + + FE+ D++E+G+GIHGE GV R ++ +ADEI Sbjct: 542 RKANLRTYTVGVALEPGSMPQTRRHNFEIGPDDMEVGMGIHGEPGVTRERIRSADEITDS 601 Query: 241 MLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALV 300 ++D + + PG V ++VN+ G +EL I+ + L + + I + Sbjct: 602 IMDRI-----FKEMKTAPGERVAVLVNSFGATPLMELYILFRRVQQRLAAKDILIEANWI 656 Query: 301 GTFMSALEMPGISLTLLLVDEPLLKLI 327 G + ++L+M G S+T+L +D+ L L+ Sbjct: 657 GHYCTSLDMAGASITILHLDQELSDLL 683 Lambda K H 0.315 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 833 Number of extensions: 51 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 575 Length of database: 695 Length adjustment: 38 Effective length of query: 537 Effective length of database: 657 Effective search space: 352809 Effective search space used: 352809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory