Align glycerone kinase (EC 2.7.1.29) (characterized)
to candidate SM_b20307 SM_b20307 dihydroxyacetone kinase
Query= BRENDA::P76014 (210 letters) >FitnessBrowser__Smeli:SM_b20307 Length = 215 Score = 134 bits (337), Expect = 1e-36 Identities = 73/191 (38%), Positives = 110/191 (57%), Gaps = 2/191 (1%) Query: 22 ESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGF--ILKNTGMTLLSSVGGA 79 E ++L+ LD IGDADHG+ M GFS V +L G ++ L++VG + Sbjct: 24 ERDHLSELDGAIGDADHGITMAIGFSAVTGELARTDAGSAGLSGVMTAAASAFLNAVGAS 83 Query: 80 SGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVE 139 +GPL+ T F RAAQA + R +L +E + + A G+ RGK + GDKTM DVW+P + Sbjct: 84 TGPLYATAFRRAAQALEGRDTLDIEACSLLIQAVASGIGERGKGQRGDKTMLDVWLPAAD 143 Query: 140 SLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMF 199 + Q+ S ++ AE+ A +T +M A KGRA+ +GERS+GH DPGA S + Sbjct: 144 AAAQAVAAAKSTAAFWADVTAAAENGASATRSMVATKGRAARVGERSLGHMDPGAASAVL 203 Query: 200 MMQMLALAAKE 210 +++ +A +E Sbjct: 204 IIRAMAQTLRE 214 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 215 Length adjustment: 21 Effective length of query: 189 Effective length of database: 194 Effective search space: 36666 Effective search space used: 36666 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory