Align ABC transporter for Glycerol, ATPase component 2 (characterized)
to candidate SM_b20661 SM_b20661 sugar uptake ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_792 (358 letters) >FitnessBrowser__Smeli:SM_b20661 Length = 355 Score = 214 bits (544), Expect = 4e-60 Identities = 128/328 (39%), Positives = 188/328 (57%), Gaps = 15/328 (4%) Query: 27 LKMEFEDGGAYALLGPSGCGKTTMLNIMSGLLVPSHGKVLFDGRDVTRASPQERNIAQVF 86 + +E EDG L+GPSGCGK+T+L +++GL + G++ + V R P++R+IA VF Sbjct: 22 VNIEIEDGEFVILVGPSGCGKSTLLRMLAGLENITAGEIRIGNQVVNRLPPKDRDIAMVF 81 Query: 87 QFPVIYDTMTVAENLAFPLRNRKVPEGQIKQRVGVIAEMLEMSGQLNQRAAGLAADAKQK 146 Q +Y MTVA+N+AF L P+ +I +RVGV AE+L +S L++ L+ +Q+ Sbjct: 82 QNYALYPHMTVADNMAFSLMLAARPKSEIDKRVGVAAEILGLSKLLDRYPRQLSGGQRQR 141 Query: 147 ISLGRGLVRADVAAVLFDEPLTVIDPHLKWQLRRKLKQIHHELKLTLIYVTHDQVEALTF 206 +++GR +VR D LFDEPL+ +D L+ +R ++K++H LK T +YVTHDQ+EA+T Sbjct: 142 VAMGRAIVR-DPQVFLFDEPLSNLDAKLRVAMRAEIKELHQRLKTTTVYVTHDQIEAMTM 200 Query: 207 ADQVVVMTRGKAVQVGSADALFERPAHTFVGHFIGSPGMNFLPAHRDGENLSV--AGHRL 264 AD++VVM G Q+G+ L++ PA+ FV FIGSP MN L D + SV Sbjct: 201 ADKIVVMHDGIVEQIGAPLELYDNPANLFVAGFIGSPAMNMLKGRLDPADPSVFLTADGT 260 Query: 265 ASPVGRALPAGALQ-----VGIRPEYLALAQPQQAGALPGTVVQVQDIGTYQMLTAKVGE 319 A PV R PA A Q G+RPEY+AL LP + ++ G L A++G Sbjct: 261 ALPVAR--PAAAAQGRDLVYGLRPEYMAL----DPNGLPAEIAVIEPTGYETQLIARLGG 314 Query: 320 HTVKARFTPETRLPSSGDTAWLQVLGEH 347 H V F G+T L + H Sbjct: 315 HDVTCVFRERVN-AKPGETIHLAIDAAH 341 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 355 Length adjustment: 29 Effective length of query: 329 Effective length of database: 326 Effective search space: 107254 Effective search space used: 107254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory