Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate SM_b20571 SM_b20571 aliphatic sulfonate ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >FitnessBrowser__Smeli:SM_b20571 Length = 281 Score = 131 bits (330), Expect = 1e-35 Identities = 77/248 (31%), Positives = 121/248 (48%) Query: 2 SARARWMLGLAFFVVFVAVWAFFTLGGFVSPTFLASPITMAKEGWLLFTEYGFIKDIGMT 61 +A W+ + F+A+W + G+++P S + W + + DI ++ Sbjct: 30 AAAGSWLSRYGLLIAFLALWQAASTAGWINPAVFPSVGAILSALWTGISGGALLDDIAIS 89 Query: 62 IWRVVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGEA 121 + R FV A V+A+PLG+ MG + IE +P + R A A P+ IL G+GEA Sbjct: 90 LQRSGTAFVGAVVLAIPLGLLMGQVRAIENALDPVLQLFRQTSALALYPVFILLLGLGEA 149 Query: 122 QKILVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAETL 181 K+ VIF ++F + L V L+E A GA + RV++PGA P I L Sbjct: 150 SKVFVIFWATLFPLLLSTISGVKEVDSKLIEMARVYGASRLTVFRRVVLPGAVPSIFVGL 209 Query: 182 RLVLGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKAL 241 RL A +I +E+IG++ GIG + ++Q + I I+ +GLVS++A Sbjct: 210 RLSATTALLLLIASEMIGANKGIGFQVMNAQYNFQIPLMFAAIFILAGLGLVSNYALVFA 269 Query: 242 NHRLFAWS 249 RL WS Sbjct: 270 QRRLCRWS 277 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 281 Length adjustment: 25 Effective length of query: 227 Effective length of database: 256 Effective search space: 58112 Effective search space used: 58112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory