Align ABC transporter for L-Histidine, permease component 2 (characterized)
to candidate SM_b21528 SM_b21528 taurine uptake ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2561 (252 letters) >FitnessBrowser__Smeli:SM_b21528 Length = 275 Score = 149 bits (376), Expect = 6e-41 Identities = 75/244 (30%), Positives = 129/244 (52%), Gaps = 4/244 (1%) Query: 9 LGLAFFVVFVAVWAFFTLGGFVSPTFLASPITMAKEGWLLFTEYGFIKDIGM----TIWR 64 + L + F+A+W T G++ P FL SP+ + + + TE + ++ R Sbjct: 28 ISLLTALAFIALWLLVTEMGWIKPLFLPSPLAVWDKFVIALTEGVSNSTLAQHTLASLGR 87 Query: 65 VVGGFVLAAVIAVPLGIAMGAYKGIEAFFEPFISFCRYLPASAFIPLLILWAGIGEAQKI 124 V+G F+LA V AVP+GI MG + + F+P I F R LP A++PL+I+W GIGE K+ Sbjct: 88 VLGAFLLALVTAVPVGILMGVNRVVRGLFDPIIEFYRPLPPLAYLPLIIIWLGIGEFPKV 147 Query: 125 LVIFIGSVFQITLMVAVTVGGARRDLVEAAYTLGAGHKGIVTRVLIPGAAPEIAETLRLV 184 +I++ + + V + + AAY +GA ++ V++ A PEI +R+ Sbjct: 148 FLIYLAIFAPMAIAARAGVRSVSTEQIHAAYAMGATRAQVIGHVILKAALPEIFTGMRIG 207 Query: 185 LGWAWTYVIVAELIGSSSGIGHMITDSQSLLNTGQIIFGIIIIGLIGLVSDFAFKALNHR 244 +G WT ++ AE++ + G+G M+ ++ L + +I GI++IG+ D + L Sbjct: 208 IGVGWTTLVAAEMVAAHRGLGFMVLNAAEYLASDTVIMGIVVIGVFAFAFDLMIRYLEKA 267 Query: 245 LFAW 248 L W Sbjct: 268 LIPW 271 Lambda K H 0.331 0.145 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 275 Length adjustment: 25 Effective length of query: 227 Effective length of database: 250 Effective search space: 56750 Effective search space used: 56750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory