Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate SMa0489 SMa0489 ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Smeli:SMa0489 Length = 255 Score = 176 bits (446), Expect = 6e-49 Identities = 93/226 (41%), Positives = 138/226 (61%), Gaps = 2/226 (0%) Query: 17 EIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEG 76 + AL+ L ++ G+ L G SG+GKSTL+R INR+EE + GRI+++G ++T + Sbjct: 26 QFEALKQVSLEVRRGEKIVLCGPSGSGKSTLIRCINRMEEHTSGRIIIDGRELTDRTKD- 84 Query: 77 LRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHAR 136 + R+ VGM+FQ FNL T+ N+ + RL E L RV + + A Sbjct: 85 INAVRREVGMVFQSFNLFPHMTILKNLTIAQRLVRKTPEKEAKEVAMHYLKRVKIPEQAS 144 Query: 137 KYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIV 196 KYP QLSGGQ+QRV IARAL +P I+L DE TSALDP+ + VL ++ ++ R+ +T++ Sbjct: 145 KYPVQLSGGQQQRVAIARALCMKPQIMLFDEPTSALDPEMISEVLDVMVDLARD-GMTMI 203 Query: 197 LITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFV 242 +THEM R V D+V MDGG ++E+GD F +P++ T F+ Sbjct: 204 CVTHEMGFARSVADRVMFMDGGQLIEEGDPETFFANPRNERTALFL 249 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 255 Length adjustment: 26 Effective length of query: 309 Effective length of database: 229 Effective search space: 70761 Effective search space used: 70761 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory