Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate SMc03865 SMc03865 amino-acid transport system permease ABC transporter protein
Query= reanno::Smeli:SMc02119 (397 letters) >FitnessBrowser__Smeli:SMc03865 Length = 273 Score = 92.0 bits (227), Expect = 2e-23 Identities = 76/264 (28%), Positives = 117/264 (44%), Gaps = 23/264 (8%) Query: 140 PPLLVIFFWYSGVLSILPQARDALALPFDIFLSNRGVAFPRPIAEEGAEYTLLAFVIAVA 199 P L+ + L+ + A D F + L GV TL+ FV+A Sbjct: 16 PWWLIALLVIAAALAAVIAANDIFTQVFTVVLKGLGVT---------VFVTLVGFVLATV 66 Query: 200 ASVFFARYARKRQLATGERLPVLWTVLGLIIGLPLVTFLV----TGAPITFDIPVAGKFN 255 + A A + + + +I G+P++ L GAP + Sbjct: 67 LGLGVALMALSEHVVLRQ---IARFYTEVIRGVPILVLLFYIAFVGAPALVTVANFVAAP 123 Query: 256 LTGGSVVGPEFMS-------LFLALSFYTAAFIAEIVRAGIRGVSKGQTEAAHALGIRPA 308 L + P + +AL +AFIAE+ RAGI+ V KGQ EAA ALG+ Sbjct: 124 LISAGWIEPFVVRDVSLMWRAIMALMIGYSAFIAEVFRAGIQSVDKGQVEAAKALGLSRY 183 Query: 309 LTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGGTILNQTGQSIEIVS 368 RLVV PQA+R+I+PPL + ++ + K+SSL +G AD+ +G + + + E S Sbjct: 184 QRFRLVVFPQAIRVILPPLGNDFVAMVKDSSLVSVLGVADITQMGKVYASGSFRFFETYS 243 Query: 369 IWLIVYLSLSLATSLFMNWYNARM 392 I VYL L++ SL + R+ Sbjct: 244 IVAYVYLVLTIGLSLALRAVERRL 267 Score = 41.2 bits (95), Expect = 4e-08 Identities = 18/59 (30%), Positives = 36/59 (61%) Query: 89 LLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKLSLAYVEVFRNIPPLLVIFF 147 +L G T+ V + G + AT++G V + LS + ++ +++ Y EV R +P L+++F+ Sbjct: 46 VLKGLGVTVFVTLVGFVLATVLGLGVALMALSEHVVLRQIARFYTEVIRGVPILVLLFY 104 Lambda K H 0.327 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 273 Length adjustment: 28 Effective length of query: 369 Effective length of database: 245 Effective search space: 90405 Effective search space used: 90405 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory