Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate SMc03135 SMc03135 amino-acid transport system ATP-binding ABC transporter protein
Query= TCDB::P73721 (252 letters) >FitnessBrowser__Smeli:SMc03135 Length = 251 Score = 250 bits (638), Expect = 2e-71 Identities = 127/244 (52%), Positives = 173/244 (70%), Gaps = 3/244 (1%) Query: 6 APLISFDQLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRL 65 +P I+ + K +G L + I ++ + I GPSG GKST +RC+NRLE GR+ Sbjct: 9 SPEITLSGVHKWYGQYHALDDINLSIASREKVVICGPSGSGKSTLIRCVNRLEAHQQGRI 68 Query: 66 EVAGVDLSGAKIDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKD 125 V GV++ D++ + +R VGMVFQ FNLFPHLT+L+N +LAP V R+P A+A + Sbjct: 69 VVGGVEVGE---DERKVDAIRREVGMVFQQFNLFPHLTILENCILAPMWVKRMPRAQATE 125 Query: 126 RALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEV 185 A+ YL++V + +A+ YP QLSGGQ+QRVAIAR LCM P+++LFDEPTSALDPE+V EV Sbjct: 126 IAMDYLNRVRIPEQANKYPGQLSGGQQQRVAIARALCMNPKVMLFDEPTSALDPEMVKEV 185 Query: 186 LNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEVFRNPKSDRLRAF 245 L+ M LA +GMTM VTHEM FAR+V++RV F +QG I EEG+P+E F +PK+DR F Sbjct: 186 LDTMVALANDGMTMVCVTHEMGFARQVADRVIFMDQGRIVEEGEPDEFFAHPKTDRASLF 245 Query: 246 LSRI 249 LS++ Sbjct: 246 LSQL 249 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 251 Length adjustment: 24 Effective length of query: 228 Effective length of database: 227 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory