Align Histidine transport ATP-binding protein HisP (characterized)
to candidate SM_b21096 SM_b21096 amino acid transporter ABC transporter ATP-binding protein
Query= SwissProt::P02915 (258 letters) >FitnessBrowser__Smeli:SM_b21096 Length = 256 Score = 238 bits (606), Expect = 1e-67 Identities = 127/245 (51%), Positives = 167/245 (68%), Gaps = 2/245 (0%) Query: 10 IDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQN 69 ID+ K YG L VSL+ G+V IIG SGSGKST LRCIN LE+ GAI V + Sbjct: 10 IDVTKNYGTFRALDKVSLEVARGEVSCIIGPSGSGKSTLLRCINLLERMDGGAIWVKDEL 69 Query: 70 INLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDA 129 I RD + +++D ++ R R+ MVFQ FNL+ H T LEN++E P+QVLG ++A Sbjct: 70 IGYRRDGNNLHEISDA-EISRQRRRIGMVFQRFNLFPHKTALENIIEGPVQVLGEPVNEA 128 Query: 130 RERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELV 189 R+RA L +VG+ ++A YP LSGGQQQRV+IARA+ M PD++LFDEPTSALDPELV Sbjct: 129 RDRAAALLERVGLADKAN-HYPSELSGGQQQRVAIARAMGMRPDLILFDEPTSALDPELV 187 Query: 190 GEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQSPRL 249 EVL +M+ LA G TM+VVTHE+GFAR+V++ V F+ GK+ E G +V P+S R Sbjct: 188 SEVLDVMRDLAASGMTMIVVTHELGFARNVANTVTFMETGKVVETGLASEVLSTPKSART 247 Query: 250 QQFLK 254 +F+K Sbjct: 248 AEFIK 252 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 256 Length adjustment: 24 Effective length of query: 234 Effective length of database: 232 Effective search space: 54288 Effective search space used: 54288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory