Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate SM_b21138 SM_b21138 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HU32 (257 letters) >FitnessBrowser__Smeli:SM_b21138 Length = 255 Score = 246 bits (628), Expect = 3e-70 Identities = 128/251 (50%), Positives = 176/251 (70%), Gaps = 1/251 (0%) Query: 5 TPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQI 64 T LEIR+LHKRYG +EVLKG+ + R G+VISI+GSSGSGK+T LRCIN+LE G I Sbjct: 2 TNLLEIRDLHKRYGTVEVLKGVDCSMRQGEVISIIGSSGSGKTTMLRCINMLEEFQGGTI 61 Query: 65 LVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLG 124 + G+E+ + + G ++I R R+ G FQ FNL+PHM+ NV+ +V Sbjct: 62 AIDGQEIGYETA-GGARRRKPEREIARQRALTGMAFQQFNLFPHMTAAANVMLGLVKVKK 120 Query: 125 KSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSAL 184 S+ EA +AE L +VG+ ++ YP QLSGGQQQR AIAR +AM PK++LFDE TSAL Sbjct: 121 MSRDEARVLAEKWLDRVGLLSRKDHYPGQLSGGQQQRVAIARAIAMNPKLMLFDEVTSAL 180 Query: 185 DPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENP 244 DPE+V EVL VI+ LAE+G +ML+VTHEM FA +VSS V+F++QG + E+G P+++F P Sbjct: 181 DPELVNEVLQVIKGLAEDGMSMLIVTHEMRFAYEVSSRVIFMNQGRIGEEGHPREMFLKP 240 Query: 245 QSARCKQFMSS 255 ++ R +F+ + Sbjct: 241 RTERLAEFLKT 251 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 255 Length adjustment: 24 Effective length of query: 233 Effective length of database: 231 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory