Align N-formylglutamate deformylase (EC 3.5.1.68) (characterized)
to candidate SM_b21164 SM_b21164 formiminoglutamase
Query= reanno::Smeli:SM_b21164 (271 letters) >FitnessBrowser__Smeli:SM_b21164 Length = 271 Score = 555 bits (1429), Expect = e-163 Identities = 271/271 (100%), Positives = 271/271 (100%) Query: 1 MAVFEVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPDATAV 60 MAVFEVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPDATAV Sbjct: 1 MAVFEVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPDATAV 60 Query: 61 RATFHRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFH 120 RATFHRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFH Sbjct: 61 RATFHRYVIDANRDPAGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFH 120 Query: 121 APYHAALSAEIARVKAIHGVVVLYDCHSIRSHIPFLFEGRLPDFNIGTDMGKTCATEIER 180 APYHAALSAEIARVKAIHGVVVLYDCHSIRSHIPFLFEGRLPDFNIGTDMGKTCATEIER Sbjct: 121 APYHAALSAEIARVKAIHGVVVLYDCHSIRSHIPFLFEGRLPDFNIGTDMGKTCATEIER 180 Query: 181 AAAEIAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMELAQSTHLATEAPPFALDR 240 AAAEIAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMELAQSTHLATEAPPFALDR Sbjct: 181 AAAEIAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMELAQSTHLATEAPPFALDR 240 Query: 241 AKADRLRRPLKAILERIETVAKELKRTGSEA 271 AKADRLRRPLKAILERIETVAKELKRTGSEA Sbjct: 241 AKADRLRRPLKAILERIETVAKELKRTGSEA 271 Lambda K H 0.320 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 396 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 271 Length adjustment: 25 Effective length of query: 246 Effective length of database: 246 Effective search space: 60516 Effective search space used: 60516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate SM_b21164 SM_b21164 (formiminoglutamase)
to HMM TIGR02017 (hutG: N-formylglutamate deformylase (EC 3.5.1.68))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02017.hmm # target sequence database: /tmp/gapView.14115.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02017 [M=263] Accession: TIGR02017 Description: hutG_amidohyd: N-formylglutamate deformylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-118 381.1 0.0 1.5e-118 381.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SM_b21164 SM_b21164 formiminoglutamase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b21164 SM_b21164 formiminoglutamase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 381.0 0.0 1.5e-118 1.5e-118 2 262 .. 3 262 .. 2 263 .. 0.99 Alignments for each domain: == domain 1 score: 381.0 bits; conditional E-value: 1.5e-118 TIGR02017 2 alevqrGkaPllislPhtGtdltdavesrlvsaakalkdtdWhieklydfardlGatvvraaisrlvidvnrdp 75 ++ev++G++P+++++PhtGtd++ ++++rl+++ ++l+dtdWhi+ ly+++ at vra+++r+vid+nrdp lcl|FitnessBrowser__Smeli:SM_b21164 3 VFEVRQGSSPVILGFPHTGTDVPASIRERLNDNGRILADTDWHIHDLYQGLLPD-ATAVRATFHRYVIDANRDP 75 5789**********************************************9987.9****************** PP TIGR02017 76 sgaslypgqattgliPettfdgeplykdGeaPseaeikkrltkyfkPyhaalraeierlralhgkivlydahsi 149 +g+slypgq+ttgl+Pet+fdg p++k+Ge P+e +i++rl ++ Pyhaal aei+r++a+hg++vlyd+hsi lcl|FitnessBrowser__Smeli:SM_b21164 76 AGVSLYPGQNTTGLVPETDFDGLPIWKEGEGPTEVDITERLRDFHAPYHAALSAEIARVKAIHGVVVLYDCHSI 149 ************************************************************************** PP TIGR02017 150 rsviPrlfeGklPdfnlGtndgkscdpaladaveavcakakglssvlnGrfkGGyitrhygqPqngvhavqlel 223 rs+iP+lfeG+lPdfn+Gt++gk+c+ ++ a+++++a a+ +s++lnGrfkGG++trhyg+P++gvha+q+el lcl|FitnessBrowser__Smeli:SM_b21164 150 RSHIPFLFEGRLPDFNIGTDMGKTCATEIERAAAEIAAGAECYSHILNGRFKGGWTTRHYGRPEQGVHAIQMEL 223 ************************************************************************** PP TIGR02017 224 aqrgyleeetePvaydeakaealravlkellealldfae 262 aq+++l+ e+ P+a d aka+ lr lk +le+++++a+ lcl|FitnessBrowser__Smeli:SM_b21164 224 AQSTHLATEAPPFALDRAKADRLRRPLKAILERIETVAK 262 ***********************************9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.57 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory