Align Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12) (characterized)
to candidate SM_b20753 SM_b20753 acyl-CoA dehydrogenase
Query= reanno::ANA3:7025618 (385 letters) >FitnessBrowser__Smeli:SM_b20753 Length = 380 Score = 423 bits (1088), Expect = e-123 Identities = 207/377 (54%), Positives = 269/377 (71%) Query: 1 MDFNFNEDQRQFADLARQFAADELAPFAAKWDEEHHFPKDVIQKAGELGFCSLYSPESEG 60 MDF +E+Q +A FA DE+AP A WD++ HFP + ++ A LG +Y + G Sbjct: 1 MDFRLSEEQEAIRTMALDFARDEIAPHAVDWDQQKHFPVETLRAAAALGMAGIYIRDDVG 60 Query: 61 GMGLSRLDASIIFEELSKGCTATTAMLTIHNMATWMVTTWGTDTLRQAWSEPLTTGQMLA 120 G GL+RLDA++I E L+ GC A + ++IHNM M+ +GTD R+ PL T +LA Sbjct: 61 GTGLTRLDAAMIIEALATGCPAIASFVSIHNMCAGMIDRYGTDEQRRRLLPPLLTMDVLA 120 Query: 121 SYCLTEPGAGSDAASLQTKAVREGDEYVVSGSKMFISGAGSTELLVVMCRTGQAGPKGIS 180 SYCLTEPG+GSDAA+L+T+AVREGD Y+++G K FISGAG + L +VM RTG+ GPKGIS Sbjct: 121 SYCLTEPGSGSDAAALKTRAVREGDAYLLTGQKQFISGAGESGLYIVMARTGEEGPKGIS 180 Query: 181 AIAIPADSEGIIYGKAEDKMGWNAQPTRLVTFDNVRVPVANLLGEEGQGFTFAMKGLDGG 240 A + D+ G+ +G E KMGW+AQPTR V DNVRV V N LG EG+GF AM GLDGG Sbjct: 181 AFVVEKDAPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLGAEGEGFRIAMAGLDGG 240 Query: 241 RINIATCSVGTAQAALERATQYMNERQQFGKPLAAFQALQFKLADMATELVAARQMVRLA 300 R++IA S+G AQ+A ++A Y+ ER+ FGK + FQALQF+LADMAT+L AR + A Sbjct: 241 RLSIAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRA 300 Query: 301 AFKLDSGDPEATAYCAMAKRFATDVGFQVCDAALQIHGGYGYIREYPLERHFRDVRVHQI 360 A LD+ DPEAT CAMAKRF TD F V + ALQ+HGGYGY+ +Y +E+ RD+RVHQI Sbjct: 301 ACALDAADPEATKLCAMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQI 360 Query: 361 LEGTNEIMRLIIARRLL 377 LEGTNEIMRLI++R ++ Sbjct: 361 LEGTNEIMRLIVSRAIM 377 Lambda K H 0.320 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 380 Length adjustment: 30 Effective length of query: 355 Effective length of database: 350 Effective search space: 124250 Effective search space used: 124250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory