Align Short-chain acyl-CoA dehydrogenase (EC 1.3.8.1) (characterized)
to candidate SMa1400 SMa1400 acyl-CoA dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2983 (375 letters) >FitnessBrowser__Smeli:SMa1400 Length = 380 Score = 292 bits (747), Expect = 1e-83 Identities = 168/374 (44%), Positives = 231/374 (61%), Gaps = 12/374 (3%) Query: 7 QQQIRDMARDFAQERLKPFAAEWDREHRFPKEAIGEMAGLGFFGMLVPEQWGGCDTGYLA 66 Q Q+RDMAR FA E ++P A DRE RFP E GEMA LG FG+ VPE GG L Sbjct: 7 QGQVRDMARAFADEVIRPMAESLDREERFPAELYGEMAKLGLFGIGVPEHLGGPGFDTLT 66 Query: 67 YAMALEEIAAGDGACSTIMSVHNSVGCVPILN-----YGTDEQKERFLKPLASGAMLGAF 121 YA+ +EE++ G SV + G V +++ +GT+ Q +R L + + + A+ Sbjct: 67 YAVVMEELSRG------YASVADQCGLVELISTLLVRHGTEGQ-QRMLPDVLNMSAKVAY 119 Query: 122 ALTEPQAGSDASGLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRGISA 181 +TEP+AG+D SG++T A +GD ++LNG K +I + A V V A TD AG RG+S Sbjct: 120 CITEPEAGTDVSGIRTTAERDGDGWMLNGGKIWIHNAPVADVGFVLARTDKEAGNRGMSI 179 Query: 182 FIVPTDSPGYKVARVEDKLGQHASDTCQILFEDVKVPLANRLGEEGEGYRIALANLEGGR 241 FIV +S G + E K+GQ AS + F DV++P LG+EG G+ + ++ L+ GR Sbjct: 180 FIVDLNSAGVERGPKEHKMGQRASQVGALTFTDVRLPGGALLGQEGRGFHMMMSVLDKGR 239 Query: 242 VGIASQSVGMARAAFEAARDYARERESFGKPIIEHQAVAFRLADMATQIAVARQMVHYAA 301 VGIA+ +VG+A+A EAA DYA R+ FGK I + Q V + LADMA I AR +VH AA Sbjct: 240 VGIAALAVGIAQAGLEAAVDYAGTRKQFGKAISDFQGVQWLLADMAKDIEAARLLVHSAA 299 Query: 302 ALRDSGKPALVEASMAKLFASEMAEKVCSSALQTLGGYGYLNDFPVERIYRDVRVCQIYE 361 + D G A S+AK FA +MA + + A+Q GG GY+ F VER+YRD ++ QIYE Sbjct: 300 SKIDRGLDATKACSIAKCFAGDMAVQRTADAVQVFGGSGYIRGFEVERLYRDAKITQIYE 359 Query: 362 GTSDIQRMVISRNL 375 GT+ IQRM+I+R L Sbjct: 360 GTNQIQRMIIAREL 373 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 380 Length adjustment: 30 Effective length of query: 345 Effective length of database: 350 Effective search space: 120750 Effective search space used: 120750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory