Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate SMc02483 SMc02483 dihydrolipoamide succinyltransferase
Query= curated2:P37942 (424 letters) >FitnessBrowser__Smeli:SMc02483 Length = 417 Score = 261 bits (667), Expect = 3e-74 Identities = 155/419 (36%), Positives = 235/419 (56%), Gaps = 22/419 (5%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ +P LGESV+E T+ W GD + +PI E+ TDKV EVP+ GT++E+V + Sbjct: 4 EIRVPTLGESVSEATVGTWFKKVGDAIKADEPILELETDKVTIEVPAPAAGTLSEIVAQA 63 Query: 65 GQTLQVGEMICKIETEGANPAE------QKQEQPAASEAAENPVAKSAGAADQPNKKRY- 117 G+T+ +G ++ +I EGA A +K+ +PAA+ AA A+ A AA Sbjct: 64 GETVGLGALLGQI-AEGAGAAAAAPAAAEKKPEPAAATAAPAAAAQPAAAAATQTSTSMP 122 Query: 118 -SPAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSA 176 +PA +L E+ + DQ+ G+G G++ + D+ + G A PA A Sbjct: 123 PAPAAAKLIAENNLSADQIDGSGKRGQVLKGDVLAAVAKG------ISAPAAAEPAKVQA 176 Query: 177 SKPEPKEETSYPASAAGDKEIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYRN 236 P P E+ AA ++ + +T +R+ IA +K ++ T EVD++ +++ R+ Sbjct: 177 RAPAPAED------AAREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRS 230 Query: 237 SIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATEDS 296 KD F+K G L F FF KAV ALKE P +N+ G +II K ++ +AV T+ Sbjct: 231 KYKDIFEKKHGVKLGFMGFFTKAVTHALKELPAVNAEVDGTEIIYKNFCHVGVAVGTDKG 290 Query: 297 LFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGII 356 L VPV+++AD+ +I I K+I L K RDG L+ DMQGGTFT++N G +GS+ S I+ Sbjct: 291 LVVPVVRDADQMSIAEIEKEIGRLGKAARDGTLSMADMQGGTFTISNGGVYGSLMSSPIL 350 Query: 357 NYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 N PQ+ IL + I RPV + G + +R M+ L LS DHR++DG FL RVK+ LE Sbjct: 351 NAPQSGILGMHKIQDRPVAI-GGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLE 408 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 417 Length adjustment: 32 Effective length of query: 392 Effective length of database: 385 Effective search space: 150920 Effective search space used: 150920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory