Align Peroxisomal bifunctional enzyme; PBE; PBFE; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 (characterized)
to candidate SM_b21632 SM_b21632 3-hydroxyacyl-CoA dehydrogenase
Query= SwissProt::Q08426 (723 letters) >FitnessBrowser__Smeli:SM_b21632 Length = 438 Score = 245 bits (626), Expect = 3e-69 Identities = 156/441 (35%), Positives = 227/441 (51%), Gaps = 26/441 (5%) Query: 268 LQYAFFAERKANKWSTPSGASWKTASARPVSSVGVVGLGTMGRGIVISFARARIPVIAVD 327 L+Y F AER A +G RP+ S V+G GTMG GI + A +P++ V+ Sbjct: 20 LRYVFHAERAARHPPALAGIE-----PRPIRSAAVIGGGTMGTGIAAALLHAGLPLVLVE 74 Query: 328 SDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTSSVK--ELGGVDLVIEAVFEE 385 D+ + A + ++ + + + S + +T S + DL+IEAVFE+ Sbjct: 75 RDEAAVERALARLRTIFDGAVKRGRISAGLAAERLAGVTGSTDYTAIAEADLIIEAVFED 134 Query: 386 MSLKKQVFAELSAVCKPEAFLCTNTSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEV 445 + +K+ VF L+AVC+ +A L TNTS LD + IA+ +G HFFSPA VMKLLE+ Sbjct: 135 LDVKRDVFRRLAAVCRADAILATNTSYLDPERIAADIGSRERFLGLHFFSPAQVMKLLEI 194 Query: 446 IPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGSKPEEV 505 +P+Q ++P +AT L++ + KI V G GF+GNR+L QA LL G+ P V Sbjct: 195 VPTQATAPDVLATGFALARMLNKIPVRAGISDGFIGNRILKVTRAQAERLLLSGATPAAV 254 Query: 506 DQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRRYCPIPDVL 565 D + FG MGPF DL GLD+ R+ AR RG + P+ D L Sbjct: 255 DAAMRAFGLPMGPFEAQDLGGLDIAAFQRRA-------------ARARGETTFAPVADRL 301 Query: 566 CELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSRYRKTHHIEPRTISQDEILERCLY 625 + RFGQK+G GWY Y P R +P +++ ++ + R + I+ L+ Sbjct: 302 SAIERFGQKSGGGWYDY-APGDRTPRPSATVARIIA--EEARGWPRRDWDEASIVGCILW 358 Query: 626 SLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQ 685 ++NEA RIL +G A ID+V +HGYG+PR +GG M +A GL V L Sbjct: 359 PMVNEAARILEDGTALRASDIDLVEIHGYGFPRWRGGLMHHAEAHGLHKVAGALSGLAEA 418 Query: 686 NPDIPQLEPSDYLKKLASQGN 706 P P D L + AS+G+ Sbjct: 419 GLADP---PCDPLLRAASRGS 436 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 723 Length of database: 438 Length adjustment: 36 Effective length of query: 687 Effective length of database: 402 Effective search space: 276174 Effective search space used: 276174 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory