Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate SMc00260 SMc00260 oxidoreductase
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__Smeli:SMc00260 Length = 254 Score = 127 bits (318), Expect = 3e-34 Identities = 87/247 (35%), Positives = 134/247 (54%), Gaps = 14/247 (5%) Query: 6 KHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELG-DNARFAVADISDEQ 64 K +++G ASG+G A++L E G +V L+D NA A+ R + D A+ ++DE+ Sbjct: 6 KSVLITGGASGIGLEIARLLHERGWRVYLMDRNADALADACRAIPIDPAQAIACSVTDEK 65 Query: 65 AAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIGSFNLLRL 124 +SA+ A +A L ++N AGI + + F ++++VNL G+F + R Sbjct: 66 EVESAIATAAAAGAPLRAVINSAGIAMDRPAVETS----VDDFRRILDVNLTGTFIVCRE 121 Query: 125 AAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAARELARFGI 184 AA A G I+N +S++ G G+AAY ASKGA+ LT A EL + GI Sbjct: 122 AARHWLATATP-----GAIVNISSVSGLVGNKGRAAYGASKGAVNLLTYILATELGQDGI 176 Query: 185 RVMTIAPGIFETPMMAGM-SDEVRASLAAGVPFPPRLGRPQEYAALARHII--ENSMLNG 241 RV IAPG +TP+ + +D+VRA +P R G +E AA A +I E S +NG Sbjct: 177 RVNAIAPGAIDTPLSRAVHTDDVRAQWHERIP-QRRYGSSREIAASAAFLISEEASYING 235 Query: 242 EVIRLDG 248 +++ +DG Sbjct: 236 QILAVDG 242 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 118 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 254 Length adjustment: 24 Effective length of query: 231 Effective length of database: 230 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory