Align Solute-binding (Aliphatic amino acid) component of ABC transporter (characterized, see rationale)
to candidate SMa0576 SMa0576 Leu or Leu/Val/Ile transport binding protein
Query= uniprot:Q1MDE9 (367 letters) >FitnessBrowser__Smeli:SMa0576 Length = 363 Score = 262 bits (669), Expect = 1e-74 Identities = 136/365 (37%), Positives = 213/365 (58%), Gaps = 2/365 (0%) Query: 3 LKTLTATLVASLAFAPLAHADITIGLIAPLTGPVAAYGDQVKNGAQTAVDEINKKGGILG 62 ++ L + A A + A++ IG+ P++G +A G Q++ GA+ AV IN GG+LG Sbjct: 1 MRHLFTAAALAFALASQSEAEVLIGVAGPMSGKLAWTGTQLRRGAEMAVANINAAGGVLG 60 Query: 63 EKVVLELADDAGEPKQGVSAANKVVGDGIRFVVGPVTSGVAIPVSDVLAENGVLMVTPTA 122 ++V L +ADD +P+Q ++AA K+V DG FV+G SG +IP S + A GVL ++P++ Sbjct: 61 QQVRLIVADDFCDPRQALAAAEKLVADGAVFVIGHYCSGASIPASKIYAAAGVLQISPSS 120 Query: 123 TAPDLTKRGLTNVLRTCGRDDQQAEVAAKYVLKNFKDKRVAIVNDKGAYGKGLADAFKAT 182 T P LT++G NV R C RDD Q A Y+ ++ D ++AI++D YGKGLAD K Sbjct: 121 TNPMLTEQGHANVFRVCSRDDAQGHKAGNYLADHWGDSKIAILHDNTTYGKGLADETKKQ 180 Query: 183 LNAGGITEVVNDAITPGDKDFSALTTRIKSEKVDVVYFGGYHPEGGLLARQLHDLAANAT 242 LN G+TE V + TPG D+S +++ + V+Y GGYH E L+ R D A Sbjct: 181 LNMRGVTEAVYQSYTPGKDDYSVEVAALQTAHIAVLYLGGYHTEAALMVRAARDRAYPVQ 240 Query: 243 IIGGDGLSNTEFWAIGTDAAGGTIFTNASDATKSPDSKAAADALAAKNIPAEAFTLNAYA 302 +I GD + F I AA GT+FT +D ++ ++ + A+N +++TL++Y Sbjct: 241 LISGDDTATEAFGLIAGPAAEGTLFTFVADPRRNAEAAEVVERFRAENFEPDSWTLHSYG 300 Query: 303 AVEVLKAGIEKAGSAEDAEAVATALKDGKEIPTAIGKVTYGETGDLTSQSFSLYKWEAGK 362 A E+ + KA S D +AV AL++ + T +G++ + + GDLT QS+ Y W++G+ Sbjct: 301 AAEIWAQAVTKANSL-DLQAVIAALRE-DQFDTVLGRIDFDKKGDLTVQSWVWYVWKSGE 358 Query: 363 IVAAE 367 V E Sbjct: 359 YVPVE 363 Lambda K H 0.312 0.131 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 363 Length adjustment: 30 Effective length of query: 337 Effective length of database: 333 Effective search space: 112221 Effective search space used: 112221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory