Align UDP-glucose 4-epimerase; UDP-galactose 4-epimerase; Uridine diphosphate galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate SM_b20458 SM_b20458 dTDP-glucose 4,6-dehydratase
Query= SwissProt::A0R5C5 (313 letters) >FitnessBrowser__Smeli:SM_b20458 Length = 348 Score = 150 bits (379), Expect = 4e-41 Identities = 103/314 (32%), Positives = 152/314 (48%), Gaps = 17/314 (5%) Query: 2 RTLVTGAAGFIGSTLVDRLLADGHGVVGLDDLSSGRAENLHSAENSDKFEFVKADIVDAD 61 R LVTG AGF+GS L + LL GH V+ LD+ S+G N+ + D F + D+V+ Sbjct: 30 RILVTGGAGFLGSHLCELLLGAGHEVICLDNFSTGLRRNIAPLKRFDTFRVIAHDVVEP- 88 Query: 62 LTGLLAEFKPEVIFHLAAQISVKRSVDDPPFDATVNVVGTVRLAEAARLAGVRKVVHTSS 121 + + + I++LA S DP V+G++ L + A G R + +S Sbjct: 89 -----IDLEVDEIYNLACPASPPHYQADPIQTTKTCVIGSLNLLDLAARRGAR--IFQAS 141 Query: 122 GGSVYGTPPAYPTSEDM-----PVNPASPYAAGKVAGEVYLNMYRNLYDLDCSHIAPANV 176 +YG P +P E P P S Y GK E + + ++ + N Sbjct: 142 TSEIYGDPHVHPQVESYWGNVNPFGPRSCYDEGKRCAETLFFDFHKSHGVEIKIVRIFNT 201 Query: 177 YGPRQDPHGEAGVVAIFSEALLAGRTTKIFGDGSDTRDYVFVDDVVDAFVR--AGGPAGG 234 YGPR P + VV+ F L G I+GDGS TR + FV+D++D FVR A P+ Sbjct: 202 YGPRMRP-DDGRVVSNFIVQALKGEDITIYGDGSQTRSFCFVEDLIDGFVRLMASPPSLT 260 Query: 235 GQRFNVGTGVETSTRELHTAIAGAVGAPDEPEFHPPRLGDLRRSRLDNTRAREVLGWQPQ 294 G N+G E + EL + G+ + P + D R+ R D + A E LGW+P+ Sbjct: 261 GP-VNLGNPAEFTIGELAEEVIRLTGSRSKIVRRPLPVDDPRQRRPDISLATEELGWRPK 319 Query: 295 VALAEGIAKTVEFF 308 V LAEG+A T+ +F Sbjct: 320 VNLAEGLAHTIRYF 333 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 348 Length adjustment: 28 Effective length of query: 285 Effective length of database: 320 Effective search space: 91200 Effective search space used: 91200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory