Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate SMc02252 SMc02252 UDP-glucose 4-epimerase
Query= SwissProt::P21977 (332 letters) >FitnessBrowser__Smeli:SMc02252 Length = 342 Score = 278 bits (710), Expect = 2e-79 Identities = 153/334 (45%), Positives = 210/334 (62%), Gaps = 6/334 (1%) Query: 1 MAILVLGGAGYIGSHMVDRLVEKGQEKVVVVDSLVTGHRAAVHPDAIFYQGDLSDQDFMR 60 MA+LV GGAGYIGSHMV L++ G E VVV+D L TG R AV P+A FY GD+ D+ ++ Sbjct: 1 MAVLVTGGAGYIGSHMVWSLLDGG-EAVVVLDCLSTGFRWAVAPEARFYFGDVGDRALLQ 59 Query: 61 KVFKENPDVDAVIHFAAYSLVGESMEKPLKYFDNNTAGMVKLLEVMNECGVKYIVFSSTA 120 +VF EN ++D+V+HFA ++V ES+ PL Y++NNTA L+ E G+++ VFSSTA Sbjct: 60 RVFAEN-EIDSVVHFAGSAVVPESVANPLAYYENNTANTRTLIAATVEAGIRHFVFSSTA 118 Query: 121 ATYGIPEEI-PILETTPQNPINPYGESKLMMETIMKWSDQAYGIKYVPLRYFNVAGANLM 179 A YG + P+ ET P +PYG SKLM E +++ + A+ ++V LRYFNVAGA+ + Sbjct: 119 AVYGTQDTPDPVSETAALRPQSPYGRSKLMSEMMLQDAAAAHDFRFVALRYFNVAGADPL 178 Query: 180 VRLVR-TRSETHLLPIILQVAQGVREKIMIFGDDYNTPDGTNVRDYVHPFDLADAHLLAV 238 R + T THL+ + + A G R KI + G DY T DGT VRDY+H DL AH A+ Sbjct: 179 GRAGQSTLGATHLIKVACEAALGRRRKIDVLGTDYPTADGTGVRDYIHVSDLVAAHRSAL 238 Query: 239 EYLRKGNESTAFNLGSSTGFSNLQILEAARKVTGKEIPAEKADRRPGDPDILIASSEKAR 298 YLR G E N G GFS LQ+L+ R+V+G++ + A RRPGDP ++A AR Sbjct: 239 AYLRAGGEPLVANCGYGHGFSVLQVLDTVRQVSGRDFMVDYAPRRPGDPAQIVADPSVAR 298 Query: 299 TVLGWKPQFDNIEKIIASAWAW--HSSHPKGYDD 330 L W P ++E I+ SA+ W H S +D+ Sbjct: 299 LKLDWVPTHASLEHIVRSAFDWESHLSRKNSFDE 332 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 342 Length adjustment: 28 Effective length of query: 304 Effective length of database: 314 Effective search space: 95456 Effective search space used: 95456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate SMc02252 SMc02252 (UDP-glucose 4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.22830.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-129 416.4 0.0 3.9e-129 416.2 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SMc02252 SMc02252 UDP-glucose 4-epimerase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SMc02252 SMc02252 UDP-glucose 4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.2 0.0 3.9e-129 3.9e-129 1 330 [. 2 326 .. 2 328 .. 0.98 Alignments for each domain: == domain 1 score: 416.2 bits; conditional E-value: 3.9e-129 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleeekidavi 75 ++LvtGgaGyiGsh+v +ll+ g vvvlD ls+g+++a+ + ++ gd+ d++ l++v++e++id+v+ lcl|FitnessBrowser__Smeli:SMc02252 2 AVLVTGGAGYIGSHMVWSLLDGGEAVVVLDCLSTGFRWAVAPEA-----RFYFGDVGDRALLQRVFAENEIDSVV 71 59**************************************9988.....5************************* PP TIGR01179 76 HfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekv.pisEesplnpinpYGrsk 149 Hfa+++ v+Esv++Pl YYenn+ nt +L+ a ++ag+++++Fss+aavYg++++ p+sE+++l p++pYGrsk lcl|FitnessBrowser__Smeli:SMc02252 72 HFAGSAVVPESVANPLAYYENNTANTRTLIAATVEAGIRHFVFSSTAAVYGTQDTPdPVSETAALRPQSPYGRSK 146 ***************************************************9988549***************** PP TIGR01179 150 lmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkrekleifGtdyptkDGtc 224 lm+E +l+d++ a +++++v+LRYFnvaGAd+ g+ G+++ +athlik+++e+a+g+r k+++ Gtdypt DGt+ lcl|FitnessBrowser__Smeli:SMc02252 147 LMSEMMLQDAAAA-HDFRFVALRYFNVAGADPLGRAGQSTLGATHLIKVACEAALGRRRKIDVLGTDYPTADGTG 220 **********999.************************************************************* PP TIGR01179 225 vRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadas 299 vRDyiHv+Dl +aH al +l +gge v n+G+g+gfsv++v+++v++vsg+d+ v a+rR+GDpa++vad+s lcl|FitnessBrowser__Smeli:SMc02252 221 VRDYIHVSDLVAAHRSALAYLRAGGEPLVANCGYGHGFSVLQVLDTVRQVSGRDFMVDYAPRRPGDPAQIVADPS 295 *************************************************************************** PP TIGR01179 300 kikrelgwkpkyddLeeiiksawdWekklke 330 ++ +l+w p++ Le+i++sa+dWe++l++ lcl|FitnessBrowser__Smeli:SMc02252 296 VARLKLDWVPTHASLEHIVRSAFDWESHLSR 326 **************************99865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.03 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory