Align D-tagatose-1,6-bisphosphate aldolase subunit KbaZ (characterized)
to candidate SM_b21373 SM_b21373 sugar kinase
Query= SwissProt::P0C8K0 (426 letters) >FitnessBrowser__Smeli:SM_b21373 Length = 426 Score = 399 bits (1024), Expect = e-115 Identities = 210/421 (49%), Positives = 268/421 (63%), Gaps = 1/421 (0%) Query: 3 HLTEMVRQHKAGKTNGIYAVCSAHPLVLEAAIRYASANQTPLLIEATSNQVDQFGGYTGM 62 HL ++ R + GI ++CSAHPLV+EAA+ A + P+LIEAT NQV+Q GGYTGM Sbjct: 5 HLIDIARWSERPGPRGIPSICSAHPLVIEAAMLRAHREKAPVLIEATCNQVNQDGGYTGM 64 Query: 63 TPADFRGFVCQLADSLNFPQDALILGGDHLGPNRWQNLPAAQAMANADDLIKSYVAAGFK 122 TP DF FV +AD + FP++ ++LGGDHLGPN W++LPA +AMA A+ +I +Y AGF Sbjct: 65 TPEDFTRFVGAIADRIEFPREKILLGGDHLGPNPWKHLPADEAMAKAEAMITAYAKAGFT 124 Query: 123 KIHLDCSMSCQDDPIPLTDDIVAERAARLAKVAEETCLEHFGEADLEYVIGTEVPVPGGA 182 K+HLD SM C +P L D A RAARLA VAE+ G + Y+IGTEVP+PGGA Sbjct: 125 KLHLDTSMGCAGEPTALPDATTAARAARLAAVAEDAVGGRGGVLPV-YIIGTEVPIPGGA 183 Query: 183 HETLSELAVTTPDAARATLEAHRHAFEKQGLNAIWPRIIALVVQPGVEFDHTNVIDYQPA 242 E L L VT P+AA T+ HR AFE+ G + R++ VVQPGVEF + NVI Y A Sbjct: 184 LEELDTLEVTAPEAAIETVRVHRAAFEEAGAAGAFSRVVGAVVQPGVEFGNENVIAYDRA 243 Query: 243 KASALSQMVENYETLIFEAHSTDYQTPQSLRQLVIDHFAILKVGPALTFALREALFSLAA 302 +A LS + ++FEAHSTDYQTP +LR+LV D FAILKVGP LTFALREAL+ L Sbjct: 244 RAEKLSATLGQLHGMVFEAHSTDYQTPDALRELVADGFAILKVGPGLTFALREALYGLDQ 303 Query: 303 IEEELVPAKACSGLRQVLEDVMLDRPEYWQSHYHGDGNARRLARGYSYSDRVRYYWPDSQ 362 I L PA L +V E VM + P W +YHG +RL R +SYSDR+RYYWP + Sbjct: 304 IAAFLFPAARERTLAEVTEAVMREEPANWAKYYHGSAEEQRLQRHFSYSDRIRYYWPHPK 363 Query: 363 IDDAFAHLVRNLADSPIPLPLISQYLPLQYVKVRSGELQPTPRELIINHIQDILAQYHTA 422 A L+ L IP LISQ+L Y +VR+GE+ P + L + + +L Y A Sbjct: 364 AAAAVDELMSLLDGVAIPETLISQFLAGSYARVRNGEVAPQAKPLALAAVDAVLQDYFAA 423 Query: 423 C 423 C Sbjct: 424 C 424 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 426 Length adjustment: 32 Effective length of query: 394 Effective length of database: 394 Effective search space: 155236 Effective search space used: 155236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory